TCP1 alpha Antibody

SKU:BHA17109329
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-TCP1 ALPHA antibody (Mouse, clone 2E7., Mouse IgG1) for IHC-P, WB, IF, FACS in research assays (RUO).
Target TCP1 ALPHA
Clone number 2E7.
Host Mouse
Reactivity Human
Isotype Mouse IgG1
Application IHC-P, WB, IF, FACS
Conjugate(s) Unconjugated
Options selector
Catalog no. Formulation Size
RQ4522 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water; Size: 100 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the TCP1 alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No RQ4522
Clonality
  • Monoclonal
Host Mouse
Immunogen Amino acids KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS were used as the immunogen for the TCP1 alpha antibody.
Isotype
  • Mouse IgG1
Product Type
  • Antibodies
  • Primary Antibodies
Purity Protein G affinity
Reactivity
  • Human
Storage After reconstitution, the TCP1 alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target TCP1 ALPHA
UniProt # P17987

Overview

TCP1 alpha Antibody is a research-use antibody directed against TCP1 ALPHA. It is supplied for use in common immunoassay contexts such as IHC-P, WB, IF, FACS (RUO).

Key elements and design rationale

  • Target: TCP1 ALPHA.
  • Description (provided): T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene.
  • Antibody type: Mouse, clone 2E7., Mouse IgG1.
  • Format: Purified; Protein G affinity.
  • Reported/predicted localization: Cytoplasm.
  • Species reactivity: tested: Human.
  • Immunogen (if provided): Amino acids KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS were used as the immunogen for the TCP1 alpha antibody..

The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.

Biological background

T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.

For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for TCP1 ALPHA, consult primary databases such as UniProt, NCBI Gene, and Ensembl.

Research relevance and current trends

  • Context-dependent expression studies: researchers often examine TCP1 ALPHA abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
  • Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
  • Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.

Common research applications

  • Immunohistochemistry for spatial mapping of target expression across tissues and cell types.
  • Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
  • Immunofluorescence for subcellular localization and cell-type specific expression patterns.
  • FACS: commonly used to detect or compare TCP1 ALPHA across experimental conditions (conceptual guidance only).

When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.

Notes for experimental interpretation

  • Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
  • Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
  • Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.

Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today