YY1 Antibody

SKU:BHA17128622
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-YY1 antibody from Mouse (clone 3F3E7) unconjugated. Designed for target detection, including Western blotting, Immunohistochemistry, Immunofluorescence; for Human, Mouse, Rat samples. Commonly used in workflows such as Western blotting, Immunohistochemistry, Immunofluorescence.
Target YY1
Clone Number 3F3E7
Conjugate(s) Unconjugated
Host Mouse
Reactivity Human, Mouse, Rat
Application WB, IHC-P, IF, FACS
Options selector
Catalog no. Formulation Size
RQ7051 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water; Size: 100 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the YY1 antibody can be stored for up to one month at 4˚C. For long-term, aliquot and store at -20˚C. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No RQ7051
Clonality
  • Monoclonal (mouse origin)
Host Mouse
Immunogen Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ were used as the immunogen for the YY1 antibody.
Isotype
  • Mouse IgG1
Product Type
  • Antibodies
  • Primary Antibodies
Purity Antigen affinity purified
Reactivity
  • Human
  • Mouse
  • Rat
Storage After reconstitution, the YY1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target YY1
UniProt # P25490

Overview

YY1 Antibody is an antibody targeting YY1, raised in Mouse for protein detection and localization studies where these specifications are required.

Key elements and design rationale

  • Target: YY1.
  • Antibody identity: Monoclonal (mouse origin); Clone 3F3E7; Mouse IgG1.
  • Conjugate/label: Unconjugated (affects detection chemistry and multiplex compatibility).
  • Format: Antigen affinity purified.
  • Species reactivity: Human, Mouse, Rat.
  • Listed applications: WB, IHC-P, IF, FACS (refer to on-page specifications for application-specific guidance).

Biological background

YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.

Research relevance and current trends

  • Comparative expression profiling across cell types, tissues, or perturbations (e.g., drug treatment, genetic editing, or differentiation).
  • Subcellular localization and trafficking studies, including co-localization with pathway markers in microscopy-based assays.
  • Integration of protein-level measurements with transcriptomics or proteomics to relate abundance to regulation and phenotype.

Common research applications

  • Western blotting: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
  • Immunohistochemistry: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
  • Immunofluorescence: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
  • Flow cytometry: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.

Interpretation should account for antibody-dependent factors such as epitope accessibility, isoforms, and sample preparation differences across workflows.

Notes for experimental interpretation

  • Isoforms and PTMs: many targets have multiple isoforms and post-translational modifications that can shift apparent signal or localization; interpret bands/signals accordingly.
  • Epitope context: binding can depend on protein conformation and sample processing; region information in the title/immunogen can help anticipate what may be detected.
  • Species differences: predicted or validated reactivity may vary by ortholog sequence and sample context; confirm in your model system.
  • Control concepts: include negative controls (no-primary/isotype), and where possible genetic controls (KO/KD) or independent antibodies to strengthen conclusions.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today