ACO2 Antibody / Aconitase 2

SKU:BHA17128848
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-ACO2 antibody from Mouse (clone 4C12D1) unconjugated. Designed for target detection, including Western blotting, Immunohistochemistry; for Human, Mouse, Rat samples. Commonly used in workflows such as Western blotting, Immunohistochemistry.
Target ACO2
Clone Number 4C12D1
Conjugate(s) Unconjugated
Host Mouse
Reactivity Human, Mouse, Rat
Application WB, IHC-P
Options selector
Catalog no. Formulation Size
RQ7281 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water; Size: 100 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the ACO2 antibody can be stored for up to one month at 4˚C. For long-term, aliquot and store at -20˚C. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No RQ7281
Clonality
  • Monoclonal (mouse origin)
Host Mouse
Immunogen Amino acids 561-596 (TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH) were used as the immunogen for the ACO2 antibody.
Isotype
  • Mouse IgG1
Product Type
  • Antibodies
  • Primary Antibodies
Purity Antigen affinity purified
Reactivity
  • Human
  • Mouse
  • Rat
Storage After reconstitution, the ACO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target ACO2
UniProt # Q99798

Overview

ACO2 Antibody / Aconitase 2 is an antibody targeting ACO2, raised in Mouse for protein detection and localization studies where these specifications are required.

Key elements and design rationale

  • Target: ACO2 (reported localization: Cytoplasmic (mitochondria)).
  • Antibody identity: Monoclonal (mouse origin); Clone 4C12D1; Mouse IgG1.
  • Conjugate/label: Unconjugated (affects detection chemistry and multiplex compatibility).
  • Format: Antigen affinity purified.
  • Species reactivity: Human, Mouse, Rat.
  • Listed applications: WB, IHC-P (refer to on-page specifications for application-specific guidance).

Biological background

Aconitase 2, mitochondrial (also called Aconitate hydratase, mitochondrial) is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15 (PRSS15), also known as Lon protease, after oxidative modification.

Research relevance and current trends

  • Comparative expression profiling across cell types, tissues, or perturbations (e.g., drug treatment, genetic editing, or differentiation).
  • Subcellular localization and trafficking studies, including co-localization with pathway markers in microscopy-based assays.
  • Integration of protein-level measurements with transcriptomics or proteomics to relate abundance to regulation and phenotype.

Common research applications

  • Western blotting: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
  • Immunohistochemistry: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.

Interpretation should account for antibody-dependent factors such as epitope accessibility, isoforms, and sample preparation differences across workflows.

Notes for experimental interpretation

  • Isoforms and PTMs: many targets have multiple isoforms and post-translational modifications that can shift apparent signal or localization; interpret bands/signals accordingly.
  • Epitope context: binding can depend on protein conformation and sample processing; region information in the title/immunogen can help anticipate what may be detected.
  • Species differences: predicted or validated reactivity may vary by ortholog sequence and sample context; confirm in your model system.
  • Control concepts: include negative controls (no-primary/isotype), and where possible genetic controls (KO/KD) or independent antibodies to strengthen conclusions.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today