Anti-GRK6 Antibody Picoband®

SKU:BHA21000609
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-GRK6 antibody (Rabbit, polyclonal, Rabbit IgG). Recommended for WB applications. Reactivity: Human. Commonly used in Cardiovascular studies, including workflows such as Detect the target by Western blot in cell or tissue lysates, Validate the target specificity with KD/KO or isotype controls (application-dependent).
Target GRK6
Host Rabbit
Reactivity Human
Isotype Rabbit IgG
Application(s) WB
Options selector
Catalog no. Size Conjugation
PB9709 100 ug/vial
Available Options

Select the variant that best fits your experiment.

  • Options:
    • 100 ug/vial / Carrier Free, Unconjugated
      Form: Lyophilized
      Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
      Applications: WB
      Application details: Western blot, 0.1-0.5μg/ml, Human
      Contents: Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
    • 100 ug/vial / APC, Biotin, Cy3, FITC, Fluoro488, Fluoro550, Fluoro594, Fluoro647, PE
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.; At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
      Applications: WB,IHC,ELISA; Flow Cytometry
      Application details: Western blot, 0.25-0.5μg/ml
      Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Flow Cytometry, 1-3μg/1x106 cellsContents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
    • 100 ug/vial / HRP
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
      Applications: WB,IHC,ELISA
      Application details: Western blot, 0.25-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Contents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: varies by selected option; see option details under Options.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No PB9709
Alternative Names G protein-coupled receptor kinase 6;2.7.11.16;G protein-coupled receptor kinase GRK6;GRK6;GPRK6;
Cellular Localization Membrane; Lipid-anchor.
Clonality
  • Polyclonal
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Host Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6, different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.
Isotype
  • Rabbit IgG
Molecular Weight 66 kDa
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Human
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Target GRK6
UniProt # P43250

Overview

This antibody is intended for detection of GRK6 (G protein-coupled receptor kinase 6) in biological samples using common immunoassay formats. It is typically selected based on target identity, species reactivity, clonality/clone information, and detection modality.

Vendor notes: Boster Bio Anti-GRK6 Antibody Picoband® catalog # PB9709. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Key elements and design rationale

  • Antibody format: Rabbit Polyclonal Rabbit IgG
  • Immunogen / epitope context: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6, different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.
  • Molecular weight context: reported MW: 66 kDa; calculated MW: 65991 MW
  • Reactivity: Human
  • Applications: WB

As a polyclonal antibody, the reagent recognizes multiple epitopes on the target, which can improve detection robustness but may increase sensitivity to sample-dependent epitope changes.

Biological background

G protein-coupled receptor kinase 6; G protein-coupled receptor kinase 6. G protein-coupled receptor kinase 6?is an?enzyme?that in humans is encoded by the?GRK6?gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses to?morphine. Functional note: Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis (By similarity). Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor: LRP6 during Wnt signaling (in vitro). . Reported localization: Membrane; Lipid-anchor. Expression/tissue context: Widely expressed. .

Research relevance and current trends

  • Cardiovascular: Researchers commonly examine how GRK6 (G protein-coupled receptor kinase 6) relates to this theme using model systems and orthogonal readouts.
  • G Protein Signaling: Researchers commonly examine how GRK6 (G protein-coupled receptor kinase 6) relates to this theme using model systems and orthogonal readouts.
  • Hypertrophy: Researchers commonly examine how GRK6 (G protein-coupled receptor kinase 6) relates to this theme using model systems and orthogonal readouts.

Common research applications

  • Western blotting: compare relative GRK6 (G protein-coupled receptor kinase 6) levels across conditions; band patterns may reflect isoforms and processing.

Notes for experimental interpretation

  • Specificity notes: No cross reactivity with other proteins.
  • Cross-reactivity: No cross-reactivity with other proteins
  • Isoforms and PTMs: Apparent size and signal patterns can differ across splice isoforms, proteolytic processing, and post-translational modifications.
  • Controls: Include an isotype control (as relevant), no-primary control for imaging, and orthogonal validation such as KD/KO samples when available.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Is this PB9709 anti-GRK6 antibody reactive to the isotypes of GRK6?
The immunogen of PB9709 anti-GRK6 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6 (382-417aa QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today