Anti-LIMK1 Antibody Picoband®

SKU:BHA21000616
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-LIMK1 antibody (Rabbit, polyclonal, Rabbit IgG). Recommended for WB applications. Reactivity: Human,Mouse,Rat. Commonly used in Neuroscience studies, including workflows such as Detect the target by Western blot in cell or tissue lysates, Validate the target specificity with KD/KO or isotype controls (application-dependent).
Target LIMK1
Host Rabbit
Reactivity Human,Mouse,Rat
Isotype Rabbit IgG
Application(s) WB
Options selector
Catalog no. Size Conjugation
PB9716 100 ug/vial
Available Options

Select the variant that best fits your experiment.

  • Options:
    • 100 ug/vial / Carrier Free, Unconjugated
      Form: Lyophilized
      Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
      Applications: WB
      Application details: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
      Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
    • 100 ug/vial / APC, Biotin, Cy3, FITC, Fluoro488, Fluoro550, Fluoro594, Fluoro647, PE
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.; At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
      Applications: WB,IHC,ELISA; Flow Cytometry
      Application details: Western blot, 0.25-0.5μg/ml
      Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Flow Cytometry, 1-3μg/1x106 cellsContents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
    • 100 ug/vial / HRP
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
      Applications: WB,IHC,ELISA
      Application details: Western blot, 0.25-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Contents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: varies by selected option; see option details under Options.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No PB9716
Alternative Names LIM domain kinase 1;LIMK-1;2.7.11.1;LIMK1;LIMK;
Cellular Localization Cytoplasm. Nucleus. Predominantly found in the cytoplasm.
Clonality
  • Polyclonal
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Host Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Isotype
  • Rabbit IgG
Molecular Weight 72 kDa
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Human
  • Mouse
  • Rat
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Target LIMK1
UniProt # P53667

Overview

This antibody is intended for detection of LIMK1 (LIM domain kinase 1) in biological samples using common immunoassay formats. It is typically selected based on target identity, species reactivity, clonality/clone information, and detection modality.

Vendor notes: Boster Bio Anti-LIMK1 Antibody Picoband® catalog # PB9716. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Key elements and design rationale

  • Antibody format: Rabbit Polyclonal Rabbit IgG
  • Immunogen / epitope context: A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
  • Molecular weight context: reported MW: 72 kDa; calculated MW: 72585 MW
  • Reactivity: Human,Mouse,Rat
  • Applications: WB

As a polyclonal antibody, the reagent recognizes multiple epitopes on the target, which can improve detection robustness but may increase sensitivity to sample-dependent epitope changes.

Biological background

LIM domain kinase 1; LIM domain kinase 1. LIM domain kinase 1?is an?enzyme?that in humans is encoded by the?LIMK1?gene. There are approximately 40 known eukaryotic LIM proteins, so named for the?LIM domains?they contain. LIM domains are highly conserved?cysteine-rich structures containing 2?zinc fingers. Although zinc fingers usually function by binding to?DNA?or?RNA, the LIM motif probably mediates?protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2?N-terminal?LIM motifs, a central?PDZ domain, and a?C-terminal?protein kinase?domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. Functional note: Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways. Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop. LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin- 2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton. In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation. Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly. Stimulates axonal outgrowth and may be involved in brain development. Isoform 3 has a dominant negative effect on actin cytoskeletal changes. Required for atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1). . Reported localization: Cytoplasm. Nucleus. Predominantly found in the cytoplasm. Expression/tissue context: Highest expression in both adult and fetal nervous system. Detected ubiquitously throughout the different regions of adult brain, with highest levels in the cerebral cortex. Expressed to a lesser extent in heart and skeletal muscle.

Research relevance and current trends

  • Actin: Researchers commonly examine how LIMK1 (LIM domain kinase 1) relates to this theme using model systems and orthogonal readouts.
  • Actin: Researchers commonly examine how LIMK1 (LIM domain kinase 1) relates to this theme using model systems and orthogonal readouts.
  • etc.: Researchers commonly examine how LIMK1 (LIM domain kinase 1) relates to this theme using model systems and orthogonal readouts.

Common research applications

  • Western blotting: compare relative LIMK1 (LIM domain kinase 1) levels across conditions; band patterns may reflect isoforms and processing.

Notes for experimental interpretation

  • Specificity notes: No cross reactivity with other proteins.
  • Cross-reactivity: No cross-reactivity with other proteins
  • Isoforms and PTMs: Apparent size and signal patterns can differ across splice isoforms, proteolytic processing, and post-translational modifications.
  • Controls: Include an isotype control (as relevant), no-primary control for imaging, and orthogonal validation such as KD/KO samples when available.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Is this PB9716 anti-LIMK1 antibody reactive to the isotypes of LIMK1?
The immunogen of PB9716 anti-LIMK1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today