| Field | Specification |
|---|---|
| Target | |
| Alternative names | ATP2A3 |
| Host | |
| Clonality | |
| Isotype | |
| Reactivity | |
| Applications | |
| Immunogen | An amino acid sequence from the N-terminus of human ATP2A3 (MEAAHLLPAADVLRHFSVTAEGGLSPAQVT) was used as the immunogen for this ATP2A3 antibody. |
| Purity | |
| Storage | |
| Storage buffer | |
| Catalog no. (Mfr.) | |
| Main SKU |
Overview
ATP2A3 antibody supplied as a antigen affinity purified reagent for WB, IHC-P in Human, Mouse, Rat samples. This product is a polyclonal (rabbit origin) antibody (host: Rabbit; isotype: Rabbit IgG) intended for research use only.
Key elements and design rationale
- Antibody identity: Polyclonal (rabbit origin); host Rabbit; isotype Rabbit IgG.
- Format and purification: format: Antigen affinity purified; purity: Antigen affinity.
- Species reactivity (reported): Human, Mouse, Rat.
- Applications (listed): WB, IHC-P.
- Immunogen / epitope context: An amino acid sequence from the N-terminus of human ATP2A3 (MEAAHLLPAADVLRHFSVTAEGGLSPAQVT) was used as the immunogen for this ATP2A3 antibody..
These attributes help you align the antibody with the biological question (target state, sample type, and readout) while keeping interpretation grounded in appropriate controls.
Biological background
ATP2A3 is the intended antigen for this primary antibody. Reported biological context includes: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2.
Research relevance and current trends
- Spatial and single-cell approaches: imaging-based and cytometry workflows increasingly quantify heterogeneity and relocalization rather than only bulk abundance.
- Interaction-centric biology: IP-based enrichment and proteomics are widely used to define complexes, binding partners, and context-specific interactomes.
Common research applications
- Western blot (WB): compare relative abundance/isoform patterns across conditions and sample types; band shifts may reflect processing or post-translational modification.
- IHC-P: commonly used to measure relative target levels or localization changes in the context of the experimental question.
Across these readouts, differences in signal intensity, localization, or complex enrichment are typically interpreted alongside sample-matched controls and independent evidence to distinguish regulation from technical variation.
Notes for experimental interpretation
- Isoforms, cleavage products, or post-translational modifications can alter apparent molecular weight and subcellular distribution; interpret bands and staining patterns in the context of expected biology and sample preparation.
- Species differences and epitope conservation may affect binding; use matched positive controls and orthogonal evidence when comparing across organisms.
- Control concepts: include appropriate isotype and secondary-only controls (for imaging), and consider genetic perturbations (knockout/knockdown/overexpression) or independent antibodies targeting distinct epitopes to strengthen conclusions.
Epitope context is defined by the immunogen description; when available, align this with known domains, PTM sites, or family homology to anticipate potential cross-reactivity patterns. As a polyclonal antibody, recognition spans multiple epitopes, which can improve detection across conformations but may broaden background depending on sample context.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.