Dihydroorotate dehydrogenase Antibody / DHODH

SKU:BHA17119148
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-DHODH antibody from Mouse, Monoclonal (mouse origin), clone 2G7, Mouse IgG2b. Listed for WB, IHC-P; supplied as purified; reactive with Human, Mouse, Rat. Commonly used in Metabolism & Enzymology, Mitochondria & Bioenergetics research, including workflows such as Validate DHODH by WB.
Target DHODH
Clone Number 2G7
Conjugate(s) Unconjugated
Host Mouse
Reactivity Human, Mouse, Rat
Options selector
Catalog no. Formulation Size
RQ6735 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Size: 100 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the Dihydroorotate dehydrogenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target DHODH
UniProt # Q02127
Host Mouse
Clone 2G7
Clonality
  • Monoclonal (mouse origin)
Isotype
  • Mouse IgG2b
Reactivity
  • Human
  • Mouse
  • Rat
Applications
  • Western Blot
  • Immunohistochemistry
Immunogen N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D from the human protein were used as the immunogen for the Dihydroorotate dehydrogenase antibody.
Purity Affinity purified
Storage After reconstitution, the Dihydroorotate dehydrogenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Storage buffer Lyophilized from 1X PBS with 2% Trehalose
Catalog no. (Mfr.) RQ6735
Main SKU BHA17119148

Overview

Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

This anti-DHODH antibody is supplied as Purified (Mouse, Monoclonal (mouse origin), clone 2G7, Mouse IgG2b, Unconjugated) and is designed to support common target-detection workflows after the on-page specifications.

Key elements and design rationale

  • Target: DHODH
  • Format: Purified
  • Localization: Cytoplasmic, nuclear
  • Species reactivity: Human, Mouse, Rat
  • Applications (listed): WB, IHC-P
  • Conjugate: Unconjugated
  • Clone and antibody class: Monoclonal (mouse origin), clone 2G7, Mouse IgG2b

Because antibody performance can depend on epitope context, sample preparation, and biological state, interpret signals using appropriate controls and orthogonal evidence when possible.

Biological background

DHODH is referenced in public gene/protein resources (e.g., UniProt and NCBI Gene), which provide curated names/synonyms, protein features, and pathway context. When designing assays, consider potential isoforms, post-translational modifications, and cell-type specific expression that may influence observed signal.

Research relevance and current trends

  • Profiling DHODH expression across model systems, perturbations, and time points to support mechanistic hypotheses.
  • Combining antibody-based detection with multi-omics or imaging readouts to link DHODH signal with phenotype.
  • Using well-matched controls (isotype controls, genetic perturbations, or independent reagents) to strengthen interpretation of target-associated signal.

Common research applications

  • WB
  • IHC-P

Use the listed applications as a starting point and tailor experimental design to your sample type and readout requirements.

Notes for experimental interpretation

  • Specificity considerations: closely related family members, isoforms, or PTMs can affect apparent specificity; confirm with independent approaches when critical.
  • Controls: include negative controls and, when feasible, genetic or pharmacologic perturbations to support target attribution in your system.
  • Species and sample context: differences in sequence, expression, fixation, or extraction conditions can change signal behavior across models.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today