| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D from the human protein were used as the immunogen for the Dihydroorotate dehydrogenase antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
This anti-DHODH antibody is supplied as Purified (Mouse, Monoclonal (mouse origin), clone 2G7, Mouse IgG2b, Unconjugated) and is designed to support common target-detection workflows after the on-page specifications.
Key elements and design rationale
- Target: DHODH
- Format: Purified
- Localization: Cytoplasmic, nuclear
- Species reactivity: Human, Mouse, Rat
- Applications (listed): WB, IHC-P
- Conjugate: Unconjugated
- Clone and antibody class: Monoclonal (mouse origin), clone 2G7, Mouse IgG2b
Because antibody performance can depend on epitope context, sample preparation, and biological state, interpret signals using appropriate controls and orthogonal evidence when possible.
Biological background
DHODH is referenced in public gene/protein resources (e.g., UniProt and NCBI Gene), which provide curated names/synonyms, protein features, and pathway context. When designing assays, consider potential isoforms, post-translational modifications, and cell-type specific expression that may influence observed signal.
Research relevance and current trends
- Profiling DHODH expression across model systems, perturbations, and time points to support mechanistic hypotheses.
- Combining antibody-based detection with multi-omics or imaging readouts to link DHODH signal with phenotype.
- Using well-matched controls (isotype controls, genetic perturbations, or independent reagents) to strengthen interpretation of target-associated signal.
Common research applications
- WB
- IHC-P
Use the listed applications as a starting point and tailor experimental design to your sample type and readout requirements.
Notes for experimental interpretation
- Specificity considerations: closely related family members, isoforms, or PTMs can affect apparent specificity; confirm with independent approaches when critical.
- Controls: include negative controls and, when feasible, genetic or pharmacologic perturbations to support target attribution in your system.
- Species and sample context: differences in sequence, expression, fixation, or extraction conditions can change signal behavior across models.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.