NIRF Antibody / HRF2

SKU:BHA17118996
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-HRF2 antibody from Mouse, Monoclonal (mouse origin), clone 6B5, Mouse IgG2b. Listed for WB, IF, FACS; supplied as antigen affinity purified; reactive with Human, Rat. Commonly used in Oncology & Angiogenesis, Protein Homeostasis & Degradation research, including workflows such as Validate HRF2 by WB.
Target HRF2
Clone Number 6B5
Conjugate(s) Unconjugated
Host Mouse
Reactivity Human, Rat
Options selector
Catalog no. Formulation Size
RQ6582 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Size: 100 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the NIRF antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target HRF2
UniProt # Q96PU4
Host Mouse
Clone 6B5
Clonality
  • Monoclonal (mouse origin)
Isotype
  • Mouse IgG2b
Reactivity
  • Human
  • Rat
Applications
  • Western Blot
  • Immunofluorescence
  • Flow Cytometry
Immunogen N-terminal region amino acids TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN from the human protein were used as the immunogen for the NIRF antibody.
Purity Antigen affinity purified
Storage After reconstitution, the NIRF antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Storage buffer Lyophilized from 1X PBS with 2% Trehalose
Catalog no. (Mfr.) RQ6582
Main SKU BHA17118996

Overview

E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

This anti-HRF2 antibody is supplied as Antigen affinity purified (Mouse, Monoclonal (mouse origin), clone 6B5, Mouse IgG2b, Unconjugated) and is designed to support common target-detection workflows after the on-page specifications.

Key elements and design rationale

  • Target: HRF2
  • Format: Antigen affinity purified
  • Localization: Cytoplasmic, nuclear
  • Species reactivity: Human, Rat
  • Applications (listed): WB, IF, FACS
  • Conjugate: Unconjugated
  • Clone and antibody class: Monoclonal (mouse origin), clone 6B5, Mouse IgG2b

Because antibody performance can depend on epitope context, sample preparation, and biological state, interpret signals using appropriate controls and orthogonal evidence when possible.

Biological background

HRF2 is referenced in public gene/protein resources (e.g., UniProt and NCBI Gene), which provide curated names/synonyms, protein features, and pathway context. When designing assays, consider potential isoforms, post-translational modifications, and cell-type specific expression that may influence observed signal.

Research relevance and current trends

  • Profiling HRF2 expression across model systems, perturbations, and time points to support mechanistic hypotheses.
  • Combining antibody-based detection with multi-omics or imaging readouts to link HRF2 signal with phenotype.
  • Using well-matched controls (isotype controls, genetic perturbations, or independent reagents) to strengthen interpretation of target-associated signal.

Common research applications

  • WB
  • IF
  • FACS

Use the listed applications as a starting point and tailor experimental design to your sample type and readout requirements.

Notes for experimental interpretation

  • Specificity considerations: closely related family members, isoforms, or PTMs can affect apparent specificity; confirm with independent approaches when critical.
  • Controls: include negative controls and, when feasible, genetic or pharmacologic perturbations to support target attribution in your system.
  • Species and sample context: differences in sequence, expression, fixation, or extraction conditions can change signal behavior across models.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Matches this product
15%OFF
15% Off Cancer Antibodies
Ends Sep 30 ONCO15
$50 OFF
$50 Off All ELISA Kits
Limited time ELISA50
10% OFF
10% OFF CELL LINES-Limited-Time Offer
Ends Sep 30 CELL10
FREE SAMPLE
Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme
Limited time offer – availa... FREESAMPLE
FREE SAMPLE
Free Sample – MycoFold™ Growth Factors
Limited time offer – availa... Request Free Sample

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today