PRKAB2 Antibody / AMPK beta 2

SKU:BHA17109312
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-PRKAB2 antibody (Mouse, clone 6G1, Mouse IgG2b) for WB, FACS in research assays (RUO).
Target PRKAB2
Clone number 6G1
Host Mouse
Reactivity Human
Isotype Mouse IgG2b
Application WB, FACS
Conjugate(s) Unconjugated
Options selector
Catalog no. Formulation Size
RQ4500 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water; Size: 100 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the PRKAB2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No RQ4500
Clonality
  • Monoclonal (mouse origin)
Host Mouse
Immunogen Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE were used as the immunogen for the PRKAB2 antibody.
Isotype
  • Mouse IgG2b
Product Type
  • Antibodies
  • Primary Antibodies
Purity Protein G affinity
Reactivity
  • Human
Storage After reconstitution, the PRKAB2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target PRKAB2
UniProt # O43741

Overview

PRKAB2 Antibody / AMPK beta 2 is a research-use antibody directed against PRKAB2. It is supplied for use in common immunoassay contexts such as WB, FACS (RUO).

Key elements and design rationale

  • Target: PRKAB2.
  • Description (provided): 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene.
  • Antibody type: Mouse, clone 6G1, Mouse IgG2b.
  • Format: Purified; Protein G affinity.
  • Species reactivity: tested: Human.
  • Immunogen (if provided): Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE were used as the immunogen for the PRKAB2 antibody..

The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.

Biological background

5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.

For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for PRKAB2, consult primary databases such as UniProt, NCBI Gene, and Ensembl.

Research relevance and current trends

  • Context-dependent expression studies: researchers often examine PRKAB2 abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
  • Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
  • Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.

Common research applications

  • Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
  • FACS: commonly used to detect or compare PRKAB2 across experimental conditions (conceptual guidance only).

When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.

Notes for experimental interpretation

  • Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
  • Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
  • Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.

Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today