| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids 20-49 (VPDKTVRWCAVSEHEATKCQSFRDHMKSVI) from the human protein were used as the immunogen for the Transferrin antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
Transferrin Antibody / TF is an antibody targeting TF, raised in Mouse for protein detection and localization studies where these specifications are required.
Key elements and design rationale
- Target: TF.
- Antibody identity: Monoclonal (mouse origin); Clone 7I11B10; Mouse IgG2b.
- Conjugate/label: Unconjugated (affects detection chemistry and multiplex compatibility).
- Format: Antigen affinity purified.
- Species reactivity: Human, Mouse, Rat.
- Listed applications: WB (refer to on-page specifications for application-specific guidance).
Biological background
Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1% (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 M?1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.
Research relevance and current trends
- Comparative expression profiling across cell types, tissues, or perturbations (e.g., drug treatment, genetic editing, or differentiation).
- Subcellular localization and trafficking studies, including co-localization with pathway markers in microscopy-based assays.
- Integration of protein-level measurements with transcriptomics or proteomics to relate abundance to regulation and phenotype.
Common research applications
- Western blotting: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
Interpretation should account for antibody-dependent factors such as epitope accessibility, isoforms, and sample preparation differences across workflows.
Notes for experimental interpretation
- Isoforms and PTMs: many targets have multiple isoforms and post-translational modifications that can shift apparent signal or localization; interpret bands/signals accordingly.
- Epitope context: binding can depend on protein conformation and sample processing; region information in the title/immunogen can help anticipate what may be detected.
- Species differences: predicted or validated reactivity may vary by ortholog sequence and sample context; confirm in your model system.
- Control concepts: include negative controls (no-primary/isotype), and where possible genetic controls (KO/KD) or independent antibodies to strengthen conclusions.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.