ABCG8 Antibody

SKU:BHA17106085
Overview
Click light‑blue chips for details
Anti-ABCG8 antibody (Rabbit; polyclonal; Rabbit IgG; antigen affinity–purified) for WB, IF in Human, Mouse, Rat samples in research assays (RUO).
Target ABCG8
Host Rabbit
Reactivity Human, Mouse, Rat
Isotype Rabbit IgG
Application(s) WB, IF
Conjugate(s) Unconjugated
Options selector
Catalog no. Formulation Size
R32789 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Size: 100 ug
  • Lead time: usually 2-3 business days, ; please contact us for current fulfillment timing.
  • Storage: After reconstitution, the ABCG8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target ABCG8
UniProt # Q9H221
Host Rabbit
Clonality
  • Polyclonal (rabbit origin)
Isotype
  • Rabbit IgG
Reactivity
  • Human
  • Mouse
  • Rat
Applications
  • Western Blot
  • Immunofluorescence
Immunogen Amino acids 328-371 (DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED) from the human protein were used as the immunogen for the ABCG8 antibody.
Conjugate
  • Unconjugated
Purity Antigen affinity
Storage After reconstitution, the ABCG8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Storage buffer Lyophilized from 1X PBS with 2% Trehalose
Catalog no. (Mfr.) R32789
Main SKU BHA17106085

Overview

ABCG8 Antibody is a research-use-only Rabbit polyclonal (rabbit origin) Rabbit IgG directed against ABCG8. It is supplied for interpretation-focused detection and comparative profiling in WB, IF.

Key elements and design rationale

  • Target context: This antibody is raised against Amino acids 328-371 (DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED) from the human protein were used as the immunogen for the ABCG8 antibody.. Epitope context matters because isoforms, processing, and post-translational modifications can change what is accessible in a given assay.
  • Format: Antigen affinity purified. Format influences background and compatibility with different detection chemistries; conjugated formats (when present) can simplify multiplexing and reduce reliance on secondary reagents.
  • Species reactivity: Human, Mouse, Rat. Cross-species performance can vary with sequence divergence and epitope conservation, so interpretation should be anchored with appropriate biological controls.
  • Applications: WB, IF. These indicate assay contexts where the antibody is commonly applied; actual performance depends on sample type and processing.
  • Limitations: This ABCG8 antibody is available for research use only.. Consider these constraints when selecting controls and when comparing results across sample matrices.

Polyclonal reagents can differ in how they recognize epitope features. Monoclonal antibodies often provide more consistent epitope targeting across lots, while polyclonal preparations may broaden recognition across related epitope variants.

Biological background

ABCG8 refers to the gene/protein target stated in the product record. Protein targets can exhibit context-dependent expression, regulated turnover, isoform diversity, and post-translational modifications that affect apparent molecular weight and epitope accessibility. For curated functional annotation, sequence features, and expression context, consult UniProtKB Q9H221, Ensembl, and Human Protein Atlas.

Research relevance and current trends

  • Integrating antibody-based detection with single-cell and spatial atlasing efforts to connect RNA programs with protein-level abundance and localization in defined cell states.
  • Expanding multiplexed imaging and high-content screening, where reagent specificity, cross-reactivity risk, and channel design (including direct conjugates) become central to interpretation.
  • Growing emphasis on reproducibility and application-specific validation frameworks (e.g., genetic perturbation controls, orthogonal measurements, and independent antibody strategies) when drawing mechanistic conclusions.

Common research applications

  • Western blot (WB): commonly used to compare relative abundance/size (e.g., band intensity or mobility shifts) between conditions.
  • Immunofluorescence (IF): commonly used to compare subcellular localization patterns and redistribution across stimuli or phenotypes.

Interpretation typically focuses on relative differences (presence/absence, fold-changes, compartment shifts, or population-level shifts) rather than absolute quantitation. When signal changes are observed, they may reflect altered expression, altered localization/trafficking, changes in modification state, or differences in sample composition; orthogonal readouts and appropriate controls help distinguish these possibilities.

Application details (record-specific): Western blot: 0.5-1ug/ml,Immunofluorescence: 5ug/ml

Application notes (record-specific): Optimal dilution of the ABCG8 antibody should be determined by the researcher.

Notes for experimental interpretation

  • Product description (record-specific): ATP-binding cassette sub-family G member 8 is a protein that in humans is encoded by the ABCG8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions to exclude non-cholesterol sterol entry at the intestinal level, promote excretion of cholesterol and sterols into bile, and to facilitate transport of sterols back into the intestinal lumen. It is expressed in a tissue-specific manner in the liver, intestine, and gallbladder. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG5. Mutations in this gene may contribute to sterol accumulation and atherosclerosis, and have been observed in patients with sitosterolemia.
  • Potential confounders: isoforms, proteolytic processing, and PTMs can change epitope presentation and apparent size; fixation/denaturation state can also expose or mask epitopes. Species differences near the epitope may affect cross-reactivity.
  • Control concepts: include genetic perturbation (KO/KD) or overexpression comparisons, orthogonal measurement (e.g., transcript or proteomics), and independent antibody/epitope strategies. For conjugated reagents, include staining-only/background controls appropriate to the detection chemistry.

Immunogen/epitope context is described as: Amino acids 328-371 (DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED) from the human protein were used as the immunogen for the ABCG8 antibody.. Monoclonal and polyclonal formats differ in epitope breadth; this can influence sensitivity to sequence variants, isoforms, or PTM-dependent recognition.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today