| Field | Specification |
|---|---|
| Target | |
| UniProt # | |
| Host | |
| Clone | |
| Clonality | |
| Isotype | |
| Reactivity | |
| Applications | |
| Immunogen | Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA were used as the immunogen for the ALDH2 antibody. |
| Purity | |
| Storage | |
| Storage buffer | |
| Catalog no. (Mfr.) | |
| Main SKU |
Overview
ALDH2 Antibody is a research-use antibody directed against ALDH2. It is supplied for use in common immunoassay contexts such as WB, FACS, IF (RUO).
Key elements and design rationale
- Target: ALDH2.
- Description (provided): ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene.
- Antibody type: Mouse, clone 5G7, Mouse IgG2a.
- Format: Antigen affinity purified; Affinity purified.
- Species reactivity: tested: Human, Mouse, Rat.
- Immunogen (if provided): Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA were used as the immunogen for the ALDH2 antibody..
The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.
Biological background
ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for ALDH2, consult primary databases such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Context-dependent expression studies: researchers often examine ALDH2 abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
- Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
- Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.
Common research applications
- Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
- FACS: commonly used to detect or compare ALDH2 across experimental conditions (conceptual guidance only).
- Immunofluorescence for subcellular localization and cell-type specific expression patterns.
When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.
Notes for experimental interpretation
- Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
- Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
- Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.
Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.