AMACR Antibody

SKU:BHA17105787
Overview
Click light‑blue chips for details
Anti-AMACR antibody (Rabbit; polyclonal; Rabbit IgG; antigen affinity–purified) for WB, IHC, IF, FACS in Human, Mouse, Rat samples in research assays (RUO).
Target AMACR
Host Rabbit
Reactivity Human, Mouse, Rat
Isotype Rabbit IgG
Application(s) WB, IHC-P, IF, FACS
Conjugate(s) Unconjugated
Options selector
Catalog no. Formulation Size
R32468 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Size: 100 ug
  • Lead time: usually 2-3 business days, ; please contact us for current fulfillment timing.
  • Storage: Prior to reconstitution, store at 4oC. After reconstitution, the AMACR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target AMACR
UniProt # Q9UHK6
Host Rabbit
Clonality
  • Polyclonal (rabbit origin)
Isotype
  • Rabbit IgG
Reactivity
  • Human
  • Mouse
  • Rat
Applications
  • Western Blot
  • Immunohistochemistry
  • Immunofluorescence
  • Flow Cytometry
Immunogen Amino acids RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK from the human protein were used as the immunogen for the AMACR antibody.
Conjugate
  • Unconjugated
Purity Antigen affinity
Storage Prior to reconstitution, store at 4oC. After reconstitution, the AMACR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Storage buffer Lyophilized from 1X PBS with 2% Trehalose
Catalog no. (Mfr.) R32468
Main SKU BHA17105787

Overview

AMACR Antibody is a research-use-only Rabbit polyclonal (rabbit origin) Rabbit IgG directed against AMACR. It is supplied for interpretation-focused detection and comparative profiling in WB, IHC, IF, FACS.

Key elements and design rationale

  • Target context: This antibody is raised against Amino acids RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK from the human protein were used as the immunogen for the AMACR antibody.. Epitope context matters because isoforms, processing, and post-translational modifications can change what is accessible in a given assay.
  • Format: Antigen affinity purified. Format influences background and compatibility with different detection chemistries; conjugated formats (when present) can simplify multiplexing and reduce reliance on secondary reagents.
  • Species reactivity: Human, Mouse, Rat. Cross-species performance can vary with sequence divergence and epitope conservation, so interpretation should be anchored with appropriate biological controls.
  • Applications: WB, IHC, IF, FACS. These indicate assay contexts where the antibody is commonly applied; actual performance depends on sample type and processing.
  • Limitations: This AMACR antibody is available for research use only.. Consider these constraints when selecting controls and when comparing results across sample matrices.

Polyclonal reagents can differ in how they recognize epitope features. Monoclonal antibodies often provide more consistent epitope targeting across lots, while polyclonal preparations may broaden recognition across related epitope variants.

Biological background

AMACR refers to the gene/protein target stated in the product record. Protein targets can exhibit context-dependent expression, regulated turnover, isoform diversity, and post-translational modifications that affect apparent molecular weight and epitope accessibility. For curated functional annotation, sequence features, and expression context, consult UniProtKB Q9UHK6, Ensembl, and Human Protein Atlas.

Research relevance and current trends

  • Integrating antibody-based detection with single-cell and spatial atlasing efforts to connect RNA programs with protein-level abundance and localization in defined cell states.
  • Expanding multiplexed imaging and high-content screening, where reagent specificity, cross-reactivity risk, and channel design (including direct conjugates) become central to interpretation.
  • Growing emphasis on reproducibility and application-specific validation frameworks (e.g., genetic perturbation controls, orthogonal measurements, and independent antibody strategies) when drawing mechanistic conclusions.

Common research applications

  • Western blot (WB): commonly used to compare relative abundance/size (e.g., band intensity or mobility shifts) between conditions.
  • Immunohistochemistry (IHC): commonly used to compare tissue- and cell-type–specific expression patterns in situ.
  • Immunofluorescence (IF): commonly used to compare subcellular localization patterns and redistribution across stimuli or phenotypes.
  • FACS: commonly used for qualitative/quantitative detection where compatible with the assay context.

Interpretation typically focuses on relative differences (presence/absence, fold-changes, compartment shifts, or population-level shifts) rather than absolute quantitation. When signal changes are observed, they may reflect altered expression, altered localization/trafficking, changes in modification state, or differences in sample composition; orthogonal readouts and appropriate controls help distinguish these possibilities.

Application details (record-specific): Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells

Application notes (record-specific): Optimal dilution of the AMACR antibody should be determined by the researcher.

Notes for experimental interpretation

  • Product description (record-specific): Alpha-methylacyl-CoA racemase (AMACR) is a mitochondrial and peroxisomal enzyme. It encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
  • Potential confounders: isoforms, proteolytic processing, and PTMs can change epitope presentation and apparent size; fixation/denaturation state can also expose or mask epitopes. Species differences near the epitope may affect cross-reactivity.
  • Control concepts: include genetic perturbation (KO/KD) or overexpression comparisons, orthogonal measurement (e.g., transcript or proteomics), and independent antibody/epitope strategies. For conjugated reagents, include staining-only/background controls appropriate to the detection chemistry.

Immunogen/epitope context is described as: Amino acids RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK from the human protein were used as the immunogen for the AMACR antibody.. Monoclonal and polyclonal formats differ in epitope breadth; this can influence sensitivity to sequence variants, isoforms, or PTM-dependent recognition.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Matches this product
15%OFF
15% Off Cancer Antibodies
Ends Sep 30 ONCO15
$50 OFF
$50 Off All ELISA Kits
Limited time ELISA50
10% OFF
10% OFF CELL LINES-Limited-Time Offer
Ends Sep 30 CELL10
FREE SAMPLE
Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme
Limited time offer – availa... FREESAMPLE
FREE SAMPLE
Free Sample – MycoFold™ Growth Factors
Limited time offer – availa... Request Free Sample

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today