ANGPTL3 Antibody / Angiopoietin-like protein 3

SKU:BHA17109008
—
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-ANGPTL3 antibody (Rabbit, Polyclonal, Rabbit IgG) for WB in research assays (RUO).
Target ANGPTL3
Host Rabbit
Reactivity Human, Mouse
Isotype Rabbit IgG
Application WB
Conjugate(s) Unconjugated
Options selector
Catalog no. Formulation Size
RQ4118 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water; Size: 100 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: After reconstitution, the ANGPTL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target ANGPTL3
UniProt # Q9Y5C1
Host Rabbit
Clonality
  • Polyclonal (rabbit origin)
Isotype
  • Rabbit IgG
Reactivity
  • Human
  • Mouse
Applications
  • Western Blot
Immunogen Amino acids RFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLN from the human protein were used as the immunogen for the ANGPTL3 antibody.
Purity Antigen affinity purified
Storage After reconstitution, the ANGPTL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Storage buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Catalog no. (Mfr.) RQ4118
Main SKU BHA17109008

Overview

ANGPTL3 Antibody / Angiopoietin-like protein 3 is a research-use antibody directed against ANGPTL3. It is supplied for use in common immunoassay contexts such as WB (RUO).

Key elements and design rationale

  • Target: ANGPTL3.
  • Description (provided): ANGPTL3 (Angiopoietin-Like 3), also known as ANGPT5, is a protein which in humans is encoded by the ANGPTL3 gene.
  • Antibody type: Rabbit, Polyclonal (rabbit origin), Rabbit IgG.
  • Format: Antigen affinity purified; Antigen affinity purified.
  • Species reactivity: tested: Human, Mouse.
  • Immunogen (if provided): Amino acids RFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLN from the human protein were used as the immunogen for the ANGPTL3 antibody..

The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.

Biological background

ANGPTL3 (Angiopoietin-Like 3), also known as ANGPT5, is a protein which in humans is encoded by the ANGPTL3 gene. The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. By radiation hybrid mapping and the use of surrounding genes, this gene is mapped to chromosome 1p31. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain and the C-terminal fibrinogen (FBN)-like domain. Angptl3 also acts as dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL), and increases plasma triglyceride and HDL cholesterol in rodents. ANGPTL3 inhibit endothelial lipase to catalyze HDL-phospholipid and increase HDL-PL levels.

For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for ANGPTL3, consult primary databases such as UniProt, NCBI Gene, and Ensembl.

Research relevance and current trends

  • Context-dependent expression studies: researchers often examine ANGPTL3 abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
  • Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
  • Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.

Common research applications

  • Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.

When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.

Notes for experimental interpretation

  • Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
  • Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
  • Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.

Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today