Anti-Cdk6 Antibody Picoband®

SKU:BHA21000900
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-CDK6 antibody (Rabbit, polyclonal, Rabbit IgG). Recommended for IHC, WB applications. Reactivity: Human,Rat. Commonly used in Oncology & Angiogenesis studies, including workflows such as Profile the target expression by IHC in FFPE tissue sections, Detect the target by Western blot in cell or tissue lysates.
Target CDK6
Host Rabbit
Reactivity Human,Rat
Isotype Rabbit IgG
Application(s) IHC, WB
Options selector
Catalog no. Size Conjugation
PB9995 100 ug/vial
Available Options

Select the variant that best fits your experiment.

  • Options:
    • 100 ug/vial / Carrier Free, Unconjugated
      Form: Lyophilized
      Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
      Applications: IHC,WB
      Application details: Western blot, 0.1-0.5μg/ml, Human, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human
      Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
    • 100 ug/vial / APC, Biotin, Cy3, FITC, Fluoro488, Fluoro550, Fluoro594, Fluoro647, PE
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.; At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
      Applications: WB,IHC,ELISA; Flow Cytometry
      Application details: Western blot, 0.25-0.5μg/ml
      Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Flow Cytometry, 1-3μg/1x106 cellsContents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
    • 100 ug/vial / HRP
      Form: Liquid
      Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
      Applications: WB,IHC,ELISA
      Application details: Western blot, 0.25-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
      ELISA, 0.1-0.5μg/ml
      Contents: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: varies by selected option; see option details under Options.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No PB9995
Alternative Names Cyclin-dependent kinase 6;2.7.11.22;Cell division protein kinase 6;Serine/threonine-protein kinase PLSTIRE;CDK6;CDKN6;
Cellular Localization Cytoplasm. Nucleus. Cell projection, ruffle. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Localized to the ruffling edge of spreading fibroblasts. Kinase activity only in nucleus. Localized to the cytosol of neurons and showed prominent staining around either side of the nucleus (By similarity). Present in the cytosol and in the nucleus in interphase cells and at the centrosome during mitosis from prophase to telophase (PubMed:23918663). .
Clonality
  • Polyclonal
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Host Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6, identical to the related mouse sequence.
Isotype
  • Rabbit IgG
Molecular Weight 39 kDa
Product Type
  • Antibodies
  • Primary Antibodies
Reactivity
  • Human
  • Rat
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Target CDK6
UniProt # Q00534

Overview

This antibody is intended for detection of CDK6 (Cyclin-dependent kinase 6) in biological samples using common immunoassay formats. It is typically selected based on target identity, species reactivity, clonality/clone information, and detection modality.

Vendor notes: Boster Bio Anti-Cdk6 Antibody Picoband® catalog # PB9995. Tested in IHC, WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Key elements and design rationale

  • Antibody format: Rabbit Polyclonal Rabbit IgG
  • Immunogen / epitope context: A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6, identical to the related mouse sequence.
  • Molecular weight context: reported MW: 39 kDa; calculated MW: 36938 MW
  • Reactivity: Human,Rat
  • Applications: IHC, WB

As a polyclonal antibody, the reagent recognizes multiple epitopes on the target, which can improve detection robustness but may increase sensitivity to sample-dependent epitope changes.

Biological background

Cyclin-dependent kinase 6; Cyclin-dependent kinase 6. Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene. The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21. Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition. This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation. It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types. In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans. Functional note: Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation; promotes G1/S transition. Phosphorylates pRB/RB1 and NPM1. Interacts with D-type G1 cyclins during interphase at G1 to form a pRB/RB1 kinase and controls the entrance into the cell cycle. Involved in initiation and maintenance of cell cycle exit during cell differentiation; prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types (e.g. erythroid and hematopoietic cells). Essential for cell proliferation within the dentate gyrus of the hippocampus and the subventricular zone of the lateral ventricles. Required during thymocyte development. Promotes the production of newborn neurons, probably by modulating G1 length. Promotes, at least in astrocytes, changes in patterns of gene expression, changes in the actin cytoskeleton including loss of stress fibers, and enhanced motility during cell differentiation. Prevents myeloid differentiation by interfering with RUNX1 and reducing its transcription transactivation activity, but promotes proliferation of normal myeloid progenitors. Delays senescence. Promotes the proliferation of beta-cells in pancreatic islets of Langerhans. May play a role in the centrosome organization during the cell cycle phases (PubMed:23918663). . Reported localization: Cytoplasm. Nucleus. Cell projection, ruffle. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Localized to the ruffling edge of spreading fibroblasts. Kinase activity only in nucleus. Localized to the cytosol of neurons and showed prominent staining around either side of the nucleus (By similarity). Present in the cytosol and in the nucleus in interphase cells and at the centrosome during mitosis from prophase to telophase (PubMed:23918663). . Expression/tissue context: Expressed ubiquitously. Accumulates in squamous cell carcinomas, proliferating hematopoietic progenitor cells, beta-cells of pancreatic islets of Langerhans, and neuroblastomas. Reduced levels in differentiating cells. .

Research relevance and current trends

  • Cancer: Researchers commonly examine how CDK6 (Cyclin-dependent kinase 6) relates to this theme using model systems and orthogonal readouts.
  • Cell Cycle: Researchers commonly examine how CDK6 (Cyclin-dependent kinase 6) relates to this theme using model systems and orthogonal readouts.
  • Epigenetics and Nuclear Signaling: Researchers commonly examine how CDK6 (Cyclin-dependent kinase 6) relates to this theme using model systems and orthogonal readouts.

Common research applications

  • Western blotting: compare relative CDK6 (Cyclin-dependent kinase 6) levels across conditions; band patterns may reflect isoforms and processing.
  • IHC/IHC-F: assess spatial distribution of CDK6 (Cyclin-dependent kinase 6) across tissue regions and cell types using matched controls.

Notes for experimental interpretation

  • Specificity notes: No cross reactivity with other proteins.
  • Cross-reactivity: No cross-reactivity with other proteins.
  • Isoforms and PTMs: Apparent size and signal patterns can differ across splice isoforms, proteolytic processing, and post-translational modifications.
  • Controls: Include an isotype control (as relevant), no-primary control for imaging, and orthogonal validation such as KD/KO samples when available.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Is this PB9995 anti-Cdk6 antibody reactive to the isotypes of CDK6?
The immunogen of PB9995 anti-Cdk6 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6 (119-150aa TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
I have a question about product PB9995, anti-Cdk6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9995 anti-Cdk6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today