Anti-SARS-CoV-2 NSP3 Antibody

SKU:BHA21003172
Suppliers
Boster Bio
Boster Bio
Details Products
Overview
Click light‑blue chips for details
Anti-rep antibody from Rabbit (Polyclonal, Rabbit IgG) Commonly used in workflows such as WB, IHC, Flow Cytometry, ELISA.
Target rep
Host Rabbit
Reactivity Human
Isotype Rabbit IgG
Application(s) WB, IHC, Flow Cytometry, ELISA
Options selector
Catalog no. Size Conjugation
A33999 100 ug/vial
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options:
    • 100 ug/vial / Carrier Free, 100 ug/vial / Unconjugated: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.; Form: Lyophilized; Applications: ELISA; Application details: ELISA, 0.001-0.1μg/ml, Human; Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
    • 100 ug/vial / APC, 100 ug/vial / Biotin, 100 ug/vial / Cy3, 100 ug/vial / FITC, 100 ug/vial / Fluoro488, 100 ug/vial / Fluoro550, 100 ug/vial / Fluoro594, 100 ug/vial / Fluoro647, 100 ug/vial / PE: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.; Form: Liquid; Applications: Flow Cytometry, WB,IHC,ELISA; Application details: Flow Cytometry, 1-3μg/1x106 cells; Western blot, 0.25-0.5μg/ml; Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml; ELISA, 0.1-0.5μg/ml; Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing., At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
    • 100 ug/vial / HRP: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.; Form: Liquid; Applications: WB,IHC,ELISA; Application details: Western blot, 0.25-0.5μg/ml; Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml; ELISA, 0.1-0.5μg/ml; Storage: At -20˚C for one year from date of receipt. Avoid repeated freezing and thawing.
  • Lead time: varies by selected option; please contact us for current fulfillment timing.
  • Storage: varies by selected option; see option details above.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible; avoid repeated freeze-thaw cycles.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target rep
Alternative names Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp3; Non-structural protein 3; PL2-PRO; Papain-like proteinase; PL-PRO
UniProt # P0DTC1/P0DTD1
Host Rabbit
Clonality
  • Polyclonal
Isotype
  • Rabbit IgG
Reactivity
  • Human
Applications
  • Western Blot
  • Immunohistochemistry
  • Flow Cytometry
  • ELISA
Immunogen HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK
Molecular weight 140 kDa, 130 kDa, 110 kDa
Purification Immunogen affinity purified.
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Cellular localization Cytoplasm .
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Catalog no. (Mfr.) A33999
Main SKU BHA21003172

Overview

Anti-SARS-CoV-2 NSP3 Antibody is an antibody for rep detection raised in Rabbit (Polyclonal, Rabbit IgG), with reported reactivity: Human. Commonly used in WB, IHC, Flow Cytometry, ELISA workflows.

Key elements and design rationale

  • Target: rep (Non-structural protein 3); UniProt: P0DTC1/P0DTD1
  • Antibody format: Rabbit, Polyclonal, Rabbit IgG
  • Molecular weight: 140 kDa, 130 kDa, 110 kDa, calculated 16693 MW
  • Applications: WB, IHC, Flow Cytometry, ELISA

Vendor description (summary): Boster Bio Anti-SARS-CoV-2 NSP3 Antibody catalog # A33999.

Biological background

Biological context: Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.

Expression and localization notes: cellular localization: Cytoplasm ., tissue context: Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. ..

Common research applications

  • Western blotting (WB): Compare rep levels across samples and conditions using appropriate loading and biological controls.
  • Immunohistochemistry (IHC): Evaluate spatial distribution of rep in tissue sections, considering fixation and antigen retrieval effects.
  • Flow cytometry: Quantify rep-positive populations in single-cell suspensions with appropriate gating and controls.
  • ELISA: Use antibody-based detection formats to assess antigen presence or binding in plate-based assays.

Notes for experimental interpretation

  • Account for isoforms, post-translational modifications, and sample-specific processing that can shift apparent molecular weight or epitope accessibility.
  • Use positive/negative biological controls where possible (e.g., known-expressing cells/tissues, knockdown/knockout models) and include appropriate secondary-only/isotype controls for imaging workflows.

Additional product notes (from provided fields)

  • Background: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.
  • Cellular localization: Cytoplasm .
  • Tissue details: Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .
  • Research category: Protein Phosphorylation,Ser/Thr Kinases,Signal Transduction

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today