| Field | Specification |
|---|---|
| Mfr No | |
| Alternative Names | Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp8; Non-structural protein 8 |
| Cellular Localization | |
| Clonality | |
| Concentration | |
| Host | |
| Immunogen | AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ |
| Isotype | |
| Molecular Weight | |
| Product Type | |
| Reactivity | |
| Reconstitution | |
| Target | |
| UniProt # |
Overview
Anti-SARS-CoV-2 NSP8 Antibody is an antibody for rep detection raised in Rabbit (Polyclonal, Rabbit IgG), with reported reactivity: Human. Commonly used in WB, IHC, Flow Cytometry, ELISA workflows.
Key elements and design rationale
- Target: rep (Non-structural protein 8); UniProt: P0DTC1/P0DTD1
- Antibody format: Rabbit, Polyclonal, Rabbit IgG
- Molecular weight: 140 kDa, 130 kDa, 110 kDa, calculated 16693 MW
- Applications: WB, IHC, Flow Cytometry, ELISA
Vendor description (summary): Boster Bio Anti-SARS-CoV-2 NSP8 Antibody catalog # A34002.
Biological background
Biological context: Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.
Expression and localization notes: cellular localization: Cytoplasm ., tissue context: Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. ..
Common research applications
- Western blotting (WB): Compare rep levels across samples and conditions using appropriate loading and biological controls.
- Immunohistochemistry (IHC): Evaluate spatial distribution of rep in tissue sections, considering fixation and antigen retrieval effects.
- Flow cytometry: Quantify rep-positive populations in single-cell suspensions with appropriate gating and controls.
- ELISA: Use antibody-based detection formats to assess antigen presence or binding in plate-based assays.
Notes for experimental interpretation
- Account for isoforms, post-translational modifications, and sample-specific processing that can shift apparent molecular weight or epitope accessibility.
- Use positive/negative biological controls where possible (e.g., known-expressing cells/tissues, knockdown/knockout models) and include appropriate secondary-only/isotype controls for imaging workflows.
Additional product notes (from provided fields)
- Background: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.
- Cellular localization: Cytoplasm .
- Tissue details: Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .
- Research category: Protein Phosphorylation,Ser/Thr Kinases,Signal Transduction
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.