Anti-Twin-Strep-tag Antibody (SAA0348)

SKU:BHA21409491
Suppliers
Biohippo Inc
Biohippo Inc
Details Products
Overview
Click light‑blue chips for details
Mouse monoclonal antibody (clone SAA0348) against Twin-Strep-tag reactive with General. RUO.
Target Twin-Strep-tag
Clone number SAA0348
Clonality Monoclonal
Application(s) ELISA, WB
Host Mouse
Options selector
Catalog no. Size
YP396033-50UG 50 ug
YP396033-100UG 100 ug
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Size (2) — 50 ug, 100 ug
  • Lead time: options listed as “in stock at manufacturer” typically ship in 5–7 business days; other statuses may take longer.
  • Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No YP396033
Alternative Names Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK
Clonality
  • Monoclonal
Form Liquid
Host Mouse
Isotype
  • IgG2b
Product Type
  • Antibodies
  • Primary Antibodies
  • Tag Antibodies
Reactivity
  • General
Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term.
Target Twin-Strep-tag

Overview
Anti-Twin-Strep-tag Antibody (SAA0348) targets Twin-Strep-tag (Twin Strep tag). Frequently used across ELISA, WB workflows, depending on experimental design and sample type. This antibody is suited for workflows commonly used in Molecular & Cellular Biology research.

Also known as: Twin Strep tag, TwinStrep tag, Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, Streptag.

Target biology

Twin-Strep-tag (Twin Strep tag) is annotated as twin strep tag and is commonly profiled for expression and localization in relevant model systems. It is frequently investigated in contexts related to Molecular & Cellular Biology. Common alternative names and symbols used in the literature include: TwinStrep tag, Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, Streptag. Based on the annotated name/class, the target is most often associated with context-dependent localization, though this can vary by model system.

How this antibody helps

As a monoclonal reagent, this antibody is designed for clone-to-clone consistency and epitope-focused recognition. For best performance, interpret signal in the context of appropriate biological controls and orthogonal readouts when available.

Recommended experimental notes

  • Titrate the antibody to optimize signal-to-noise for your specific sample type and detection system.
  • Use appropriate positive and negative controls (e.g., target-high vs target-low samples, KO/KD where available).
  • For Western blotting, use fresh protease (and phosphatase, if relevant) inhibitors and confirm the primary band at the expected molecular weight; additional bands may reflect isoforms or processing.
  • For ELISA, optimize capture/detection pairing and run a standard curve in matrix-matched diluent when possible.

Additional notes

For research use only.

For research use only. Not for diagnostic procedures.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today