| Field | Specification |
|---|---|
| Mfr No | |
| Alternative Names | Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK |
| Clonality | |
| Form | Liquid |
| Host | |
| Isotype | |
| Product Type | |
| Reactivity | |
| Storage | |
| Target |
Overview
Anti-Twin-Strep-tag Antibody (SAA0348) targets Twin-Strep-tag (Twin Strep tag). Frequently used across ELISA, WB workflows, depending on experimental design and sample type. This antibody is suited for workflows commonly used in Molecular & Cellular Biology research.
Also known as: Twin Strep tag, TwinStrep tag, Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, Streptag.
Target biology
Twin-Strep-tag (Twin Strep tag) is annotated as twin strep tag and is commonly profiled for expression and localization in relevant model systems. It is frequently investigated in contexts related to Molecular & Cellular Biology. Common alternative names and symbols used in the literature include: TwinStrep tag, Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK, Streptag. Based on the annotated name/class, the target is most often associated with context-dependent localization, though this can vary by model system.
How this antibody helps
As a monoclonal reagent, this antibody is designed for clone-to-clone consistency and epitope-focused recognition. For best performance, interpret signal in the context of appropriate biological controls and orthogonal readouts when available.
Recommended experimental notes
- Titrate the antibody to optimize signal-to-noise for your specific sample type and detection system.
- Use appropriate positive and negative controls (e.g., target-high vs target-low samples, KO/KD where available).
- For Western blotting, use fresh protease (and phosphatase, if relevant) inhibitors and confirm the primary band at the expected molecular weight; additional bands may reflect isoforms or processing.
- For ELISA, optimize capture/detection pairing and run a standard curve in matrix-matched diluent when possible.
Additional notes
For research use only.
For research use only. Not for diagnostic procedures.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.