ARC Antibody / Activity-regulated cytoskeleton-associated protein

SKU:BHA17105601
Overview
Click light‑blue chips for details
Anti-ARC / Activity-regulated cytoskeleton-associated protein antibody (Rabbit; polyclonal; Rabbit IgG; antigen affinity–purified) for WB in Human, Mouse, Rat samples in research assays (RUO).
Target ARC
Host Rabbit
Reactivity Human, Mouse, Rat
Isotype Rabbit IgG
Application(s) WB
Conjugate(s) Unconjugated
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Size: 100 ug
  • Lead time: usually 2-3 business days, ; please contact us for current fulfillment timing.
  • Storage: After reconstitution, the ARC antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Options selector
Catalog no. Formulation Size
R32271 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Field Specification
Clonality
  • Polyclonal (rabbit origin)
Conjugate
  • Unconjugated
Host Rabbit
Immunogen Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.
Isotype
  • Rabbit IgG
Product Type
  • Antibodies
  • Primary Antibodies
Purity Antigen affinity
Reactivity
  • Human
  • Mouse
  • Rat
Storage After reconstitution, the ARC antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target ARC
UniProt # Q7LC44

Overview

ARC Antibody / Activity-regulated cytoskeleton-associated protein is a research-use-only Rabbit polyclonal (rabbit origin) Rabbit IgG directed against ARC / Activity-regulated cytoskeleton-associated protein. It is supplied for interpretation-focused detection and comparative profiling in WB.

Key elements and design rationale

  • Target context: This antibody is raised against Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.. Epitope context matters because isoforms, processing, and post-translational modifications can change what is accessible in a given assay.
  • Format: Antigen affinity purified. Format influences background and compatibility with different detection chemistries; conjugated formats (when present) can simplify multiplexing and reduce reliance on secondary reagents.
  • Species reactivity: Human, Mouse, Rat. Cross-species performance can vary with sequence divergence and epitope conservation, so interpretation should be anchored with appropriate biological controls.
  • Applications: WB. These indicate assay contexts where the antibody is commonly applied; actual performance depends on sample type and processing.
  • Limitations: This ARC antibody is available for research use only.. Consider these constraints when selecting controls and when comparing results across sample matrices.

Polyclonal reagents can differ in how they recognize epitope features. Monoclonal antibodies often provide more consistent epitope targeting across lots, while polyclonal preparations may broaden recognition across related epitope variants.

Biological background

ARC / Activity-regulated cytoskeleton-associated protein refers to the gene/protein target stated in the product record. Protein targets can exhibit context-dependent expression, regulated turnover, isoform diversity, and post-translational modifications that affect apparent molecular weight and epitope accessibility. For curated functional annotation, sequence features, and expression context, consult UniProtKB Q7LC44, Ensembl, and Human Protein Atlas.

Research relevance and current trends

  • Integrating antibody-based detection with single-cell and spatial atlasing efforts to connect RNA programs with protein-level abundance and localization in defined cell states.
  • Expanding multiplexed imaging and high-content screening, where reagent specificity, cross-reactivity risk, and channel design (including direct conjugates) become central to interpretation.
  • Growing emphasis on reproducibility and application-specific validation frameworks (e.g., genetic perturbation controls, orthogonal measurements, and independent antibody strategies) when drawing mechanistic conclusions.

Common research applications

  • Western blot (WB): commonly used to compare relative abundance/size (e.g., band intensity or mobility shifts) between conditions.

Interpretation typically focuses on relative differences (presence/absence, fold-changes, compartment shifts, or population-level shifts) rather than absolute quantitation. When signal changes are observed, they may reflect altered expression, altered localization/trafficking, changes in modification state, or differences in sample composition; orthogonal readouts and appropriate controls help distinguish these possibilities.

Application details (record-specific): Western blot: 0.1-0.5ug/ml

Application notes (record-specific): Optimal dilution of the ARC antibody should be determined by the researcher.

Notes for experimental interpretation

  • Product description (record-specific): Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
  • Potential confounders: isoforms, proteolytic processing, and PTMs can change epitope presentation and apparent size; fixation/denaturation state can also expose or mask epitopes. Species differences near the epitope may affect cross-reactivity.
  • Control concepts: include genetic perturbation (KO/KD) or overexpression comparisons, orthogonal measurement (e.g., transcript or proteomics), and independent antibody/epitope strategies. For conjugated reagents, include staining-only/background controls appropriate to the detection chemistry.

Immunogen/epitope context is described as: Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.. Monoclonal and polyclonal formats differ in epitope breadth; this can influence sensitivity to sequence variants, isoforms, or PTM-dependent recognition.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Research budgets are tight — we get it. That's why we've put together a fresh round of exclusive promotions designed to help you stock up on the reagents, kits, and consumables your lab depends on, without stretching your budget.

🔬 What's on offer right now:

10% Off Pre-Designed siRNA Sets

20% Off Transmembrane Proteins

$50 Off All ELISA Kits

50% Off Lab Consumables + Free Shipping

$99 Pipette Filler Promotion Package

BlasTaq 2X qPCR MasterMix - 50% OFF Limited Time Offer

DENARASE® Endonuclease — 10% Off One Order

10% OFF CELL LINES-Limited-Time Offer

15% Off Proteins from Trusted Suppliers — Limited Time

👉 Browse all current deals

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Supplier Ads Slides show

Add dynamic ads with slider