| Field | Specification |
|---|---|
| Mfr No | |
| Alternative Names | ATG13 |
| Clonality | |
| Host | |
| Immunogen | Amino acids MAEDLDSLPEKLAVHEKNVREFDAFVETLQ of human ATG13 were used as the immunogen for the ATG13 antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
ATG13 antibody supplied as a antigen affinity purified reagent for WB in Human, Mouse samples. This product is a polyclonal (rabbit origin) antibody (host: Rabbit; isotype: Rabbit IgG) intended for research use only.
Key elements and design rationale
- Antibody identity: Polyclonal (rabbit origin); host Rabbit; isotype Rabbit IgG.
- Format and purification: format: Antigen affinity purified; purity: Antigen affinity.
- Species reactivity (reported): Human, Mouse.
- Applications (listed): WB.
- Immunogen / epitope context: Amino acids MAEDLDSLPEKLAVHEKNVREFDAFVETLQ of human ATG13 were used as the immunogen for the ATG13 antibody..
These attributes help you align the antibody with the biological question (target state, sample type, and readout) while keeping interpretation grounded in appropriate controls.
Biological background
ATG13 is the intended antigen for this primary antibody. Reported biological context includes: Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation.
Research relevance and current trends
- Post-translational modification mapping: phosphorylation-site–resolved antibodies are used to connect signaling inputs to target activation states and downstream readouts.
- Signal-flow and turnover studies: researchers pair immunodetection with perturbations that modulate enzymatic activity or proteostasis to understand regulation, stability, and feedback.
- Spatial and single-cell approaches: imaging-based and cytometry workflows increasingly quantify heterogeneity and relocalization rather than only bulk abundance.
Common research applications
- Western blot (WB): compare relative abundance/isoform patterns across conditions and sample types; band shifts may reflect processing or post-translational modification.
Across these readouts, differences in signal intensity, localization, or complex enrichment are typically interpreted alongside sample-matched controls and independent evidence to distinguish regulation from technical variation.
Notes for experimental interpretation
- Isoforms, cleavage products, or post-translational modifications can alter apparent molecular weight and subcellular distribution; interpret bands and staining patterns in the context of expected biology and sample preparation.
- Species differences and epitope conservation may affect binding; use matched positive controls and orthogonal evidence when comparing across organisms.
- Control concepts: include appropriate isotype and secondary-only controls (for imaging), and consider genetic perturbations (knockout/knockdown/overexpression) or independent antibodies targeting distinct epitopes to strengthen conclusions.
Epitope context is defined by the immunogen description; when available, align this with known domains, PTM sites, or family homology to anticipate potential cross-reactivity patterns. As a polyclonal antibody, recognition spans multiple epitopes, which can improve detection across conformations but may broaden background depending on sample context.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.