Bmi1 Antibody

SKU:BHA17104941
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Rabbit polyclonal antibody against Bmi1 Rabbit IgG. Supplied as Antigen affinity purified; Antigen affinity; for WB; in Human, Mouse, Rat samples for research use only.
Target Bmi1
Host Rabbit
Reactivity Human, Mouse, Rat
Application(s) WB
Clonality Polyclonal
Options selector
Catalog no. Formulation Size
R31554 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: see the variant selector for available formats and sizes.
  • Lead time: 2–3 business days.
  • Storage: After reconstitution, the Bmi1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20ºC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No R31554
Alternative Names Bmi1
Clonality
  • Polyclonal
Host Rabbit
Immunogen An amino acid sequence from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR) was used as the immunogen for this Bmi1 antibody.
Isotype
  • Rabbit IgG
Product Type
  • Antibodies
  • Primary Antibodies
Purity Antigen affinity
Reactivity
  • Human
  • Mouse
  • Rat
Storage After reconstitution, the Bmi1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target Bmi1

Overview

Bmi1 antibody supplied as a antigen affinity purified reagent for WB in Human, Mouse, Rat samples. This product is a polyclonal (rabbit origin) antibody (host: Rabbit; isotype: Rabbit IgG) intended for research use only.

Key elements and design rationale

  • Antibody identity: Polyclonal (rabbit origin); host Rabbit; isotype Rabbit IgG.
  • Format and purification: format: Antigen affinity purified; purity: Antigen affinity.
  • Species reactivity (reported): Human, Mouse, Rat.
  • Applications (listed): WB.
  • Immunogen / epitope context: An amino acid sequence from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR) was used as the immunogen for this Bmi1 antibody..

These attributes help you align the antibody with the biological question (target state, sample type, and readout) while keeping interpretation grounded in appropriate controls.

Biological background

Bmi1 is the intended antigen for this primary antibody. Reported biological context includes: B lymphoma Mo MLV insertion region 1, also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain.

Research relevance and current trends

  • Spatial and single-cell approaches: imaging-based and cytometry workflows increasingly quantify heterogeneity and relocalization rather than only bulk abundance.
  • Interaction-centric biology: IP-based enrichment and proteomics are widely used to define complexes, binding partners, and context-specific interactomes.

Common research applications

  • Western blot (WB): compare relative abundance/isoform patterns across conditions and sample types; band shifts may reflect processing or post-translational modification.

Across these readouts, differences in signal intensity, localization, or complex enrichment are typically interpreted alongside sample-matched controls and independent evidence to distinguish regulation from technical variation.

Notes for experimental interpretation

  • Isoforms, cleavage products, or post-translational modifications can alter apparent molecular weight and subcellular distribution; interpret bands and staining patterns in the context of expected biology and sample preparation.
  • Species differences and epitope conservation may affect binding; use matched positive controls and orthogonal evidence when comparing across organisms.
  • Control concepts: include appropriate isotype and secondary-only controls (for imaging), and consider genetic perturbations (knockout/knockdown/overexpression) or independent antibodies targeting distinct epitopes to strengthen conclusions.

Epitope context is defined by the immunogen description; when available, align this with known domains, PTM sites, or family homology to anticipate potential cross-reactivity patterns. As a polyclonal antibody, recognition spans multiple epitopes, which can improve detection across conformations but may broaden background depending on sample context.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today