| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK were used as the immunogen for the FH antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
FH Antibody / Fumarate hydratase is an antibody targeting FH, raised in Mouse for protein detection and localization studies where these specifications are required.
Key elements and design rationale
- Target: FH (reported localization: Cytoplasmic, mitochondrial).
- Antibody identity: Monoclonal (mouse origin); Clone 9D8; Mouse IgG2a.
- Conjugate/label: Unconjugated (affects detection chemistry and multiplex compatibility).
- Format: Purified.
- Species reactivity: Human, Mouse, Rat, Monkey.
- Listed applications: WB, IHC-P (refer to on-page specifications for application-specific guidance).
Biological background
Fumarase (or fumarate hydratase) is an enzyme that catalyzes the reversible hydration/dehydration of fumarate to malate. Fumarase comes in two forms: mitochondrial and cytosolic. The mitochondrial isoenzyme is involved in the Krebs Cycle (also known as the Tricarboxylic Acid Cycle [TCA] or the Citric Acid Cycle), and the cytosolic isoenzyme is involved in the metabolism of amino acids and fumarate. Subcellular localization is established by the presence of a signal sequence on the amino terminus in the mitochondrial form, while subcellular localization in the cytosolic form is established by the absence of the signal sequence found in the mitochondrial variety. This enzyme participates in 2 metabolic pathways: citric acid cycle, reductive citric acid cycle (CO2 fixation), and is also important in renal cell carcinoma. Mutations in this gene have been associated with the development of leiomyomas in the skin and uterus in combination with renal cell carcinoma.
Research relevance and current trends
- Comparative expression profiling across cell types, tissues, or perturbations (e.g., drug treatment, genetic editing, or differentiation).
- Subcellular localization and trafficking studies, including co-localization with pathway markers in microscopy-based assays.
- Integration of protein-level measurements with transcriptomics or proteomics to relate abundance to regulation and phenotype.
Common research applications
- Western blotting: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
- Immunohistochemistry: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
Interpretation should account for antibody-dependent factors such as epitope accessibility, isoforms, and sample preparation differences across workflows.
Notes for experimental interpretation
- Isoforms and PTMs: many targets have multiple isoforms and post-translational modifications that can shift apparent signal or localization; interpret bands/signals accordingly.
- Epitope context: binding can depend on protein conformation and sample processing; region information in the title/immunogen can help anticipate what may be detected.
- Species differences: predicted or validated reactivity may vary by ortholog sequence and sample context; confirm in your model system.
- Control concepts: include negative controls (no-primary/isotype), and where possible genetic controls (KO/KD) or independent antibodies to strengthen conclusions.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.