| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
This anti-GDF9 antibody is supplied as Purified (Mouse, Monoclonal (mouse origin), clone GDF9/4261, Mouse IgG1, Unconjugated) and is designed to support common target-detection workflows after the on-page specifications.
Key elements and design rationale
- Target: GDF9
- Format: Purified
- Localization: Cytoplasmic (secreted)
- Species reactivity: Human
- Applications (listed): ELISA, WB, IHC-P
- Conjugate: Unconjugated
- Clone and antibody class: Monoclonal (mouse origin), clone GDF9/4261, Mouse IgG1
Because antibody performance can depend on epitope context, sample preparation, and biological state, interpret signals using appropriate controls and orthogonal evidence when possible.
Biological background
GDF9 is referenced in public gene/protein resources (e.g., UniProt and NCBI Gene), which provide curated names/synonyms, protein features, and pathway context. When designing assays, consider potential isoforms, post-translational modifications, and cell-type specific expression that may influence observed signal.
Research relevance and current trends
- Profiling GDF9 expression across model systems, perturbations, and time points to support mechanistic hypotheses.
- Combining antibody-based detection with multi-omics or imaging readouts to link GDF9 signal with phenotype.
- Using well-matched controls (isotype controls, genetic perturbations, or independent reagents) to strengthen interpretation of target-associated signal.
Common research applications
- ELISA
- WB
- IHC-P
Use the listed applications as a starting point and tailor experimental design to your sample type and readout requirements.
Notes for experimental interpretation
- Specificity considerations: closely related family members, isoforms, or PTMs can affect apparent specificity; confirm with independent approaches when critical.
- Controls: include negative controls and, when feasible, genetic or pharmacologic perturbations to support target attribution in your system.
- Species and sample context: differences in sequence, expression, fixation, or extraction conditions can change signal behavior across models.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.