GDF9 Antibody

SKU:BHA17118457
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Anti-GDF9 antibody from Mouse, Monoclonal (mouse origin), clone GDF9/4261, Mouse IgG1. Listed for ELISA, WB, IHC-P; supplied as purified; reactive with Human. Commonly used in Developmental Biology, Cell Signaling research, including workflows such as Validate GDF9 by WB.
Target GDF9
Clone Number GDF9/4261
Conjugate(s) Unconjugated
Host Mouse
Reactivity Human
Options selector
Catalog no. Formulation Size
V8671-100UG 0.2 mg/ml in 1X PBS with 0.1 mg/ml BSA (US sourced) and 0.05% sodium azide
V8671SAF-100UG 1 mg/ml in 1X PBS; BSA free, sodium azide free
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation (2) - 0.2 mg/ml in 1X PBS with 0.1 mg/ml BSA (US sourced) and 0.05% sodium azide, 1 mg/ml in 1X PBS; BSA free, sodium azide free
    Size (2) - 100 ug, 20 ug
  • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
  • Storage: Store the GDF9 antibody at 2-8oC (with azide) or aliquot and store at -20oC or colder (without azide).
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target GDF9
UniProt # O60383
Host Mouse
Clone GDF9/4261
Clonality
  • Monoclonal (mouse origin)
Isotype
  • Mouse IgG1
Reactivity
  • Human
Applications
  • ELISA
  • Western Blot
  • Immunohistochemistry
Immunogen Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG.
Purity Protein G affinity chromatography
Storage Store the GDF9 antibody at 2-8oC (with azide) or aliquot and store at -20oC or colder (without azide).
Catalog no. (Mfr.) V8671
Main SKU BHA17118457

Overview

GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

This anti-GDF9 antibody is supplied as Purified (Mouse, Monoclonal (mouse origin), clone GDF9/4261, Mouse IgG1, Unconjugated) and is designed to support common target-detection workflows after the on-page specifications.

Key elements and design rationale

  • Target: GDF9
  • Format: Purified
  • Localization: Cytoplasmic (secreted)
  • Species reactivity: Human
  • Applications (listed): ELISA, WB, IHC-P
  • Conjugate: Unconjugated
  • Clone and antibody class: Monoclonal (mouse origin), clone GDF9/4261, Mouse IgG1

Because antibody performance can depend on epitope context, sample preparation, and biological state, interpret signals using appropriate controls and orthogonal evidence when possible.

Biological background

GDF9 is referenced in public gene/protein resources (e.g., UniProt and NCBI Gene), which provide curated names/synonyms, protein features, and pathway context. When designing assays, consider potential isoforms, post-translational modifications, and cell-type specific expression that may influence observed signal.

Research relevance and current trends

  • Profiling GDF9 expression across model systems, perturbations, and time points to support mechanistic hypotheses.
  • Combining antibody-based detection with multi-omics or imaging readouts to link GDF9 signal with phenotype.
  • Using well-matched controls (isotype controls, genetic perturbations, or independent reagents) to strengthen interpretation of target-associated signal.

Common research applications

  • ELISA
  • WB
  • IHC-P

Use the listed applications as a starting point and tailor experimental design to your sample type and readout requirements.

Notes for experimental interpretation

  • Specificity considerations: closely related family members, isoforms, or PTMs can affect apparent specificity; confirm with independent approaches when critical.
  • Controls: include negative controls and, when feasible, genetic or pharmacologic perturbations to support target attribution in your system.
  • Species and sample context: differences in sequence, expression, fixation, or extraction conditions can change signal behavior across models.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today