| Field | Specification |
|---|---|
| Target | |
| UniProt # | |
| Host | |
| Clone | |
| Clonality | |
| Isotype | |
| Reactivity | |
| Applications | |
| Immunogen | Amino acids 454-488 (QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ) from the human protein were used as the immunogen for the HSP90AA1 antibody. |
| Purity | |
| Storage | |
| Storage buffer | |
| Catalog no. (Mfr.) | |
| Main SKU |
Overview
Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. This gene encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.
This anti-HSP90AA1 antibody is supplied as Antigen affinity purified (Mouse, Monoclonal (mouse origin), clone 6B5, Mouse IgG2b, Unconjugated) and is designed to support common target-detection workflows after the on-page specifications.
Key elements and design rationale
- Target: HSP90AA1
- Format: Antigen affinity purified
- Localization: Cell membrane, cytoplasmic, nuclear
- Species reactivity: Human, Mouse, Rat, Monkey
- Applications (listed): WB, IHC-P, IF, FACS
- Conjugate: Unconjugated
- Clone and antibody class: Monoclonal (mouse origin), clone 6B5, Mouse IgG2b
Because antibody performance can depend on epitope context, sample preparation, and biological state, interpret signals using appropriate controls and orthogonal evidence when possible.
Biological background
HSP90AA1 is referenced in public gene/protein resources (e.g., UniProt and NCBI Gene), which provide curated names/synonyms, protein features, and pathway context. When designing assays, consider potential isoforms, post-translational modifications, and cell-type specific expression that may influence observed signal.
Research relevance and current trends
- Profiling HSP90AA1 expression across model systems, perturbations, and time points to support mechanistic hypotheses.
- Combining antibody-based detection with multi-omics or imaging readouts to link HSP90AA1 signal with phenotype.
- Using well-matched controls (isotype controls, genetic perturbations, or independent reagents) to strengthen interpretation of target-associated signal.
Common research applications
- WB
- IHC-P
- IF
- FACS
Use the listed applications as a starting point and tailor experimental design to your sample type and readout requirements.
Notes for experimental interpretation
- Specificity considerations: closely related family members, isoforms, or PTMs can affect apparent specificity; confirm with independent approaches when critical.
- Controls: include negative controls and, when feasible, genetic or pharmacologic perturbations to support target attribution in your system.
- Species and sample context: differences in sequence, expression, fixation, or extraction conditions can change signal behavior across models.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.