KCNH2/HERG Blocking Peptide

SKU:BHP21301027 Toxins and Venom Peptides
—
Suppliers
Alomone Labs
Alomone Labs
Details Products
Overview
Click light‑blue chips for details
KCNH2/HERG Blocking Peptide is a reagent targeting KCNH2. Key specifications include Form: Lyophilized powder; Purity: >95% (SDS-PAGE). Commonly used in molecular and cellular biology studies, including use kcnh2 as a tool reagent in cell-based assays… and validate readouts by western blot.
Target KCNH2
Purity >95% (SDS-PAGE)
Form Lyophilized powder
Options selector
Catalog no. Size
BLP-PC062-120MCG-1 120 mcg
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options:
    Size: 120 mcg
  • Lead time: typically ships in ~1-2 business days; timing may vary by selected option.
  • Storage: Storage before reconstitution: Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C Storage after reconstitution: -20°C.
  • Shipping: Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target KCNH2
Accession number Q12809
Applications
  • Western Blot
  • Immunohistochemistry
Purity >95% (SDS-PAGE)
Reconstitution 100 μl PBS
Concentration 1.2 mg/ml.
Formulation Lyophilized Powder.
Form Lyophilized powder
Storage Storage before reconstitution: Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C Storage after reconstitution: -20°C.
Shipping Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Catalog no. (Mfr.) BLP-PC062
Main SKU BHP21301027

Overview

KCNH2/HERG Blocking Peptide is a GST fusion protein used in research settings. It is commonly applied as a tool reagent related to KCNH2 biology and/or assay development. It is supplied in Lyophilized powder format to support flexible downstream use in RUO workflows. Researchers commonly pair it with applications such as WB, IHC, CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA.

Key elements and design rationale

  • Quality attributes: Purity: >95% (SDS-PAGE); Identity/confirmation: Confirmed by DNA sequence and SDS-PAGE; Lot QC: Western blot analysis..
  • Immunogen context: GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG).
  • Antigen preadsorption control: 3 µg fusion protein per 1 µg antibody.

When used as a biochemical or pharmacological tool, results are best interpreted relative to the experimental system (species, expression level, and assay readout) and with appropriate negative and competition-style controls where relevant. This product is intended for research use only.

Biological background

Protein and peptide reagents are widely used to probe molecular mechanisms, benchmark assay performance, and support reagent validation. Interpretation depends on the assay context (e.g., binding, functional modulation, competition, or detection) and on how closely the reagent’s sequence/structure matches the biological target in the experimental system.

Research relevance and current trends

  • Using high-specificity ligands, toxins, and engineered peptides to dissect closely related receptor/channel subtypes and signaling microdomains.
  • Pairing labeled (e.g., fluorescent) proteins/peptides with advanced imaging to map surface expression, trafficking, and nanoscale organization.
  • Expanding rigor in antibody validation, including competition/preadsorption concepts and orthogonal approaches (genetic, pharmacologic, and biochemical controls).

Common research applications

  • WB: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • IHC: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • CBE- Cell-based ELISA: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • FC- Flow cytometry: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • ICC- Immunocytochemistry: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • IE- Indirect ELISA: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • IF- Immunofluorescence: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • IFC- Indirect flow cytometry: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • IHC- Immunohistochemistry: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • IP- Immunoprecipitation: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • LCI- Live cell imaging: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • N- Neutralization: commonly used to compare signal, binding, or functional readouts across conditions without implying a specific protocol.
  • Antibody-related use: often referenced as the immunogen for antibody generation (GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)), supporting interpretation of epitope-dependent results.
  • Specificity control concept: can support antigen preadsorption-style controls (3 µg fusion protein per 1 µg antibody) as part of an overall validation strategy.

Across these use cases, changes in signal or functional readout are generally interpreted as evidence of differences in target abundance, accessibility, or engagement, but alternative explanations (matrix effects, off-target interactions, or assay artifacts) should be considered.

Notes for experimental interpretation

  • Assay context matters: binding assays, functional modulation, and detection workflows can yield different readouts even for the same target system.
  • Target complexity: closely related family members, splice variants, and post-translational modifications can influence apparent specificity and potency.
  • Matrix and sample effects: buffer composition, detergents, and biological matrices may alter stability or apparent activity; interpret with appropriate controls.
  • Control concepts: competition/preadsorption should be considered alongside orthogonal controls (e.g., genetic perturbation, alternative ligands, or independent antibodies).

Can’t Find What You’re Looking For? We can help you source the best match or customize a recombinant protein solution for your study. Options may include species (human/mouse/rat), protein region/domain (full-length vs fragment), tag or label (His/GST/FLAG/biotin/fluorescent), expression system (E. coli/HEK293/insect), purity grade, formulation (buffer, carrier-free, glycerol-free), activity/functional validation (binding or enzymatic assays), endotoxin level (low-endotoxin for cell-based work), mutants/variants (point mutations, isoforms), and bulk or custom packaging. Click Talk to a Scientist to submit a request form, email us at support@biohippo.com, or explore our Research Services for additional support. Our team will be in contact with you shortly.

Matches this product
FREE SAMPLE
Free Sample – MycoFold™ Growth Factors
Limited time offer – availa... Request Free Sample
Matches this product
15% OFF
15% Off Proteins from Trusted Suppliers — Limited Time
Limited Time PT15OFF
$50 OFF
$50 Off All ELISA Kits
Limited time ELISA50
FREE SAMPLE
Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme
Limited time offer – availa... FREESAMPLE

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today