Kv1.2 Antibody

Overview

Kv1.2 Antibody is a research-use-only Rabbit polyclonal (rabbit origin) Rabbit IgG directed against Kv1.2. It is supplied for interpretation-focused detection and comparative profiling in WB, IF, FACS.

Key elements and design rationale

• Target context: This antibody is raised against Amino acids NNSNEDFREENLKTANCTLANTNYVNITKMLTDV of human Kv1.2 were used as the immunogen for the Kv1.2 antibody.. Epitope context matters because isoforms, processing, and post-translational modifications can change what is accessible in a given assay.
• Format: Antigen affinity purified. Format influences background and compatibility with different detection chemistries; conjugated formats (when present) can simplify multiplexing and reduce reliance on secondary reagents.
• Species reactivity: Human, Mouse, Rat. Cross-species performance can vary with sequence divergence and epitope conservation, so interpretation should be anchored with appropriate biological controls.
• Applications: WB, IF, FACS. These indicate assay contexts where the antibody is commonly applied; actual performance depends on sample type and processing.
• Limitations: This Kv1.2 antibody is available for research use only.. Consider these constraints when selecting controls and when comparing results across sample matrices.

Polyclonal reagents can differ in how they recognize epitope features. Monoclonal antibodies often provide more consistent epitope targeting across lots, while polyclonal preparations may broaden recognition across related epitope variants.

Biological background

Kv1.2 refers to the gene/protein target stated in the product record. Protein targets can exhibit context-dependent expression, regulated turnover, isoform diversity, and post-translational modifications that affect apparent molecular weight and epitope accessibility. For curated functional annotation, sequence features, and expression context, consult UniProtKB P16389, Ensembl, and Human Protein Atlas.

Research relevance and current trends

• Integrating antibody-based detection with single-cell and spatial atlasing efforts to connect RNA programs with protein-level abundance and localization in defined cell states.
• Expanding multiplexed imaging and high-content screening, where reagent specificity, cross-reactivity risk, and channel design (including direct conjugates) become central to interpretation.
• Growing emphasis on reproducibility and application-specific validation frameworks (e.g., genetic perturbation controls, orthogonal measurements, and independent antibody strategies) when drawing mechanistic conclusions.

Common research applications

• Western blot (WB): commonly used to compare relative abundance/size (e.g., band intensity or mobility shifts) between conditions.
• Immunofluorescence (IF): commonly used to compare subcellular localization patterns and redistribution across stimuli or phenotypes.
• FACS: commonly used for qualitative/quantitative detection where compatible with the assay context.

Interpretation typically focuses on relative differences (presence/absence, fold-changes, compartment shifts, or population-level shifts) rather than absolute quantitation. When signal changes are observed, they may reflect altered expression, altered localization/trafficking, changes in modification state, or differences in sample composition; orthogonal readouts and appropriate controls help distinguish these possibilities.

Application details (record-specific): Western blot: 0.1-0.5ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells

Application notes (record-specific): Optimal dilution of the Kv1.2 antibody should be determined by the researcher.

Notes for experimental interpretation

• Product description (record-specific): Potassium voltage-gated channel subfamily A member 2, also known as Kv1.2, is a protein that in humans is encoded by the KCNA2 gene. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1.
• Potential confounders: isoforms, proteolytic processing, and PTMs can change epitope presentation and apparent size; fixation/denaturation state can also expose or mask epitopes. Species differences near the epitope may affect cross-reactivity.
• Control concepts: include genetic perturbation (KO/KD) or overexpression comparisons, orthogonal measurement (e.g., transcript or proteomics), and independent antibody/epitope strategies. For conjugated reagents, include staining-only/background controls appropriate to the detection chemistry.

Immunogen/epitope context is described as: Amino acids NNSNEDFREENLKTANCTLANTNYVNITKMLTDV of human Kv1.2 were used as the immunogen for the Kv1.2 antibody.. Monoclonal and polyclonal formats differ in epitope breadth; this can influence sensitivity to sequence variants, isoforms, or PTM-dependent recognition.

• Datasheet (KV12-ANTIBODY-R31982)

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.