MMP-8 Antibody

SKU:BHA17105368
Overview
Click light‑blue chips for details
Anti-MMP-8 antibody (Rabbit; polyclonal; Rabbit IgG; antigen affinity–purified) for WB, IHC, ELISA (protein) in Human samples in research assays (RUO).
Target MMP-8
Host Rabbit
Reactivity Human
Isotype Rabbit IgG
Application(s) WB, IHC-P, ELISA (protein)
Conjugate(s) Unconjugated
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Size: 100 ug
  • Lead time: usually 2-3 business days, ; please contact us for current fulfillment timing.
  • Storage: After reconstitution, the MMP-8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Options selector
Catalog no. Formulation Size
R32022 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Field Specification
Clonality
  • Polyclonal (rabbit origin)
Conjugate
  • Unconjugated
Host Rabbit
Immunogen Amino acids NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ of human MMP8 were used as the immunogen for the MMP-8 antibody.
Isotype
  • Rabbit IgG
Product Type
  • Antibodies
  • Primary Antibodies
Purity Antigen affinity
Reactivity
  • Human
Storage After reconstitution, the MMP-8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target MMP-8
UniProt # P22894

Overview

MMP-8 Antibody is a research-use-only Rabbit polyclonal (rabbit origin) Rabbit IgG directed against MMP-8. It is supplied for interpretation-focused detection and comparative profiling in WB, IHC, ELISA (protein). Reported localization context: Cytoplasmic.

Key elements and design rationale

  • Target context: This antibody is raised against Amino acids NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ of human MMP8 were used as the immunogen for the MMP-8 antibody.. Epitope context matters because isoforms, processing, and post-translational modifications can change what is accessible in a given assay.
  • Format: Antigen affinity purified. Format influences background and compatibility with different detection chemistries; conjugated formats (when present) can simplify multiplexing and reduce reliance on secondary reagents.
  • Species reactivity: Human. Cross-species performance can vary with sequence divergence and epitope conservation, so interpretation should be anchored with appropriate biological controls.
  • Localization: Cytoplasmic. Subcellular compartment context can help guide expectations in imaging assays and informs fractionation-based comparisons in lysate workflows.
  • Applications: WB, IHC, ELISA (protein). These indicate assay contexts where the antibody is commonly applied; actual performance depends on sample type and processing.

Polyclonal reagents can differ in how they recognize epitope features. Monoclonal antibodies often provide more consistent epitope targeting across lots, while polyclonal preparations may broaden recognition across related epitope variants.

Biological background

MMP-8 refers to the gene/protein target stated in the product record. Protein targets can exhibit context-dependent expression, regulated turnover, isoform diversity, and post-translational modifications that affect apparent molecular weight and epitope accessibility. For curated functional annotation, sequence features, and expression context, consult UniProtKB P22894, Ensembl, and Human Protein Atlas.

Research relevance and current trends

  • Integrating antibody-based detection with single-cell and spatial atlasing efforts to connect RNA programs with protein-level abundance and localization in defined cell states.
  • Expanding multiplexed imaging and high-content screening, where reagent specificity, cross-reactivity risk, and channel design (including direct conjugates) become central to interpretation.
  • Growing emphasis on reproducibility and application-specific validation frameworks (e.g., genetic perturbation controls, orthogonal measurements, and independent antibody strategies) when drawing mechanistic conclusions.

Common research applications

  • Western blot (WB): commonly used to compare relative abundance/size (e.g., band intensity or mobility shifts) between conditions.
  • Immunohistochemistry (IHC): commonly used to compare tissue- and cell-type–specific expression patterns in situ.
  • ELISA (protein): commonly used for qualitative/quantitative detection where compatible with the assay context.

Interpretation typically focuses on relative differences (presence/absence, fold-changes, compartment shifts, or population-level shifts) rather than absolute quantitation. When signal changes are observed, they may reflect altered expression, altered localization/trafficking, changes in modification state, or differences in sample composition; orthogonal readouts and appropriate controls help distinguish these possibilities.

Application details (record-specific): Western blot: 0.1-0.5ug/ml,IHC (FFPE): 0.5-1ug/ml,ELISA: 0.1-0.5ug/ml (human protein tested); request BSA-free format for coating

Application notes (record-specific): Optimal dilution of the MMP-8 antibody should be determined by the researcher.

Notes for experimental interpretation

  • Product description (record-specific): MMP-8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP-8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.
  • Potential confounders: isoforms, proteolytic processing, and PTMs can change epitope presentation and apparent size; fixation/denaturation state can also expose or mask epitopes. Species differences near the epitope may affect cross-reactivity.
  • Control concepts: include genetic perturbation (KO/KD) or overexpression comparisons, orthogonal measurement (e.g., transcript or proteomics), and independent antibody/epitope strategies. For conjugated reagents, include staining-only/background controls appropriate to the detection chemistry.

Immunogen/epitope context is described as: Amino acids NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ of human MMP8 were used as the immunogen for the MMP-8 antibody.. Monoclonal and polyclonal formats differ in epitope breadth; this can influence sensitivity to sequence variants, isoforms, or PTM-dependent recognition.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Research budgets are tight — we get it. That's why we've put together a fresh round of exclusive promotions designed to help you stock up on the reagents, kits, and consumables your lab depends on, without stretching your budget.

🔬 What's on offer right now:

10% Off Pre-Designed siRNA Sets

20% Off Transmembrane Proteins

$50 Off All ELISA Kits

50% Off Lab Consumables + Free Shipping

$99 Pipette Filler Promotion Package

BlasTaq 2X qPCR MasterMix - 50% OFF Limited Time Offer

DENARASE® Endonuclease — 10% Off One Order

10% OFF CELL LINES-Limited-Time Offer

15% Off Proteins from Trusted Suppliers — Limited Time

👉 Browse all current deals

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Supplier Ads Slides show

Add dynamic ads with slider