| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids DRLVLASIDQADFQGFTYVNPDFVHPDARS were used as the immunogen for the PKC gamma antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
PKC gamma Antibody / PRKCG is a research-use antibody directed against PKC GAMMA. It is supplied for use in common immunoassay contexts such as WB, IHC-P, IF (RUO).
Key elements and design rationale
- Target: PKC GAMMA.
- Description (provided): The gamma isotype of protein kinase C (PKC gamma) is a member of the classical PKC (cPKC) subfamily which is activated by Ca(2+) and diacylglycerol in the presence of phosphatidylserine.
- Antibody type: Rabbit, Polyclonal (rabbit origin), Rabbit IgG.
- Format: Antigen affinity purified; Antigen affinity purified.
- Reported/predicted localization: Cytoplasmic.
- Species reactivity: tested: Human, Mouse, Rat.
- Immunogen (if provided): Amino acids DRLVLASIDQADFQGFTYVNPDFVHPDARS were used as the immunogen for the PKC gamma antibody..
The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.
Biological background
The gamma isotype of protein kinase C (PKC gamma) is a member of the classical PKC (cPKC) subfamily which is activated by Ca(2+) and diacylglycerol in the presence of phosphatidylserine. Physiologically, PKC gamma is activated by a mechanism coupled with receptor-mediated breakdown of inositol phospholipid as other cPKC isotypes such as PKC alpha and PKC beta. PKC gamma is expressed solely in the brain and spinal cord and its localization is restricted to neurons, while PKC alpha and PKC beta are expressed in many tissues in addition to the brain. Within the brain, PKC gamma is the most abundant in the cerebellum, hippocampus and cerebral cortex, where the existence of neuronal plasticity has been demonstrated. PKC gamma gene is mutated in spinocerebellar ataxia type 14 (SCA14). Verbeek et al. (2005) point out the specific alterations in mutant PKC gamma function that could lead to the selective neuronal degeneration of SCA14.
For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for PKC GAMMA, consult primary databases such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Context-dependent expression studies: researchers often examine PKC GAMMA abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
- Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
- Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.
Common research applications
- Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
- Immunohistochemistry for spatial mapping of target expression across tissues and cell types.
- Immunofluorescence for subcellular localization and cell-type specific expression patterns.
When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.
Notes for experimental interpretation
- Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
- Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
- Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.
Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.