| Field | Specification |
|---|---|
| Alternative Names | PPP1R12A / Myosin Phosphatase / MYPT1 |
| Clonality | |
| Host | |
| Immunogen | Amino acids MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD of human PPP1R12A were used as the immunogen for the PPP1R12A antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
PPP1R12A antibody supplied as a antigen affinity purified reagent for WB, IHC-P, FACS, IF in Human, Mouse samples. This product is a polyclonal (rabbit origin) antibody (host: Rabbit; isotype: Rabbit IgG) intended for research use only. The target is commonly annotated with cytoplasmic localization context, which may inform staining patterns.
Key elements and design rationale
- Antibody identity: Polyclonal (rabbit origin); host Rabbit; isotype Rabbit IgG.
- Format and purification: format: Antigen affinity purified; purity: Antigen affinity.
- Species reactivity (reported): Human, Mouse.
- Applications (listed): WB, IHC-P, FACS, IF.
- Immunogen / epitope context: Amino acids MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD of human PPP1R12A were used as the immunogen for the PPP1R12A antibody..
- Localization: Cytoplasmic (annotation-level guidance; cell state and isoforms can shift patterns).
These attributes help you align the antibody with the biological question (target state, sample type, and readout) while keeping interpretation grounded in appropriate controls.
Biological background
PPP1R12A is the intended antigen for this primary antibody. Reported biological context includes: PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Subcellular localization information (Cytoplasmic) can be useful when interpreting IF/ICC patterns and selecting compartment-enriched lysates for WB.
Research relevance and current trends
- Post-translational modification mapping: phosphorylation-site–resolved antibodies are used to connect signaling inputs to target activation states and downstream readouts.
- Signal-flow and turnover studies: researchers pair immunodetection with perturbations that modulate enzymatic activity or proteostasis to understand regulation, stability, and feedback.
- Spatial and single-cell approaches: imaging-based and cytometry workflows increasingly quantify heterogeneity and relocalization rather than only bulk abundance.
Common research applications
- Western blot (WB): compare relative abundance/isoform patterns across conditions and sample types; band shifts may reflect processing or post-translational modification.
- IHC-P: commonly used to measure relative target levels or localization changes in the context of the experimental question.
- FACS: commonly used to measure relative target levels or localization changes in the context of the experimental question.
- Immunofluorescence (IF): visualize localization and co-localization patterns in cells or tissues.
Across these readouts, differences in signal intensity, localization, or complex enrichment are typically interpreted alongside sample-matched controls and independent evidence to distinguish regulation from technical variation.
Notes for experimental interpretation
- Isoforms, cleavage products, or post-translational modifications can alter apparent molecular weight and subcellular distribution; interpret bands and staining patterns in the context of expected biology and sample preparation.
- Species differences and epitope conservation may affect binding; use matched positive controls and orthogonal evidence when comparing across organisms.
- Control concepts: include appropriate isotype and secondary-only controls (for imaging), and consider genetic perturbations (knockout/knockdown/overexpression) or independent antibodies targeting distinct epitopes to strengthen conclusions.
Epitope context is defined by the immunogen description; when available, align this with known domains, PTM sites, or family homology to anticipate potential cross-reactivity patterns. As a polyclonal antibody, recognition spans multiple epitopes, which can improve detection across conformations but may broaden background depending on sample context.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.
Research budgets are tight — we get it. That's why we've put together a fresh round of exclusive promotions designed to help you stock up on the reagents, kits, and consumables your lab depends on, without stretching your budget.
🔬 What's on offer right now:
10% Off Pre-Designed siRNA Sets
20% Off Transmembrane Proteins
50% Off Lab Consumables + Free Shipping
$99 Pipette Filler Promotion Package
BlasTaq 2X qPCR MasterMix - 50% OFF Limited Time Offer
DENARASE® Endonuclease — 10% Off One Order