| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids QNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEA were used as the immunogen for the PRDM14 antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
PRDM14 Antibody is a research-use primary antibody intended for detection of PRDM14 in experimental workflows. It is supplied in Purified format. Key antibody attributes include Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG. Applications listed for this product include WB, IHC-P, IF, FACS. Reported/annotated localization context: Nuclear. Species reactivity (as provided): Human, Mouse, Rat.
Key elements and design rationale
- Target: PRDM14 — selectivity and interpretation should be considered in the context of isoforms, post-translational modifications, and related family members when applicable.
- Format: Purified — format can influence background, multiplexing compatibility, and downstream detection strategies.
- Antibody identity: Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG — these attributes help align secondary reagents and controls (e.g., isotype-matched controls) with your assay design.
- Localization: Nuclear — expected subcellular distribution can guide band/structure interpretation and help flag off-target signal.
- Product notes (from provided description): This gene encodes a member of the PRDI-BF1 and RIZ homology domain containing (PRDM) family of transcriptional regulators. The encoded protein may possess histone methyltransferase activity and plays a critical role in cell pluripotency by suppressing the expression of differentiation marker genes. Expression of this gene may play a role in breast cancer.
Where multiple assay formats are possible, align the antibody format, host/isotype, and listed applications with your detection system and controls to support clear interpretation of signal.
Biological background
In this catalog, PRDM14 is positioned within Molecular & Cellular Biology, Cancer research contexts. Localization annotations (e.g., Nuclear) can help contextualize expected signal patterns in imaging and fractionation-based readouts. For authoritative gene/protein nomenclature, domains/isoforms, and curated functional annotations, consult resources such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Higher-plex and spatially resolved readouts (e.g., multiplex IF/IHC, spatial omics) are increasing demand for well-characterized primary antibodies with clearly stated host/isotype and labeling strategies.
- Genetic perturbation controls (knockout/knockdown) and orthogonal measurements (e.g., RNA vs protein) are commonly used to strengthen target attribution when interpreting antibody-derived signals.
- Reproducibility initiatives emphasize transparent reporting of antibody identity (clone, host, isotype) and experimental context to improve cross-study comparability.
Common research applications
- WB: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- IHC-P: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- IF: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- FACS: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- Typical workflow themes: Western blot validation, IHC on FFPE tissue, IF/ICC localization, Flow cytometry staining, Specificity controls.
- Workflow notes: Validate PRDM14 by Western blot in cell/tissue lysates (include controls), Detect PRDM14 by IHC in FFPE tissue sections (optimize antigen retrieval + dilution), Detect PRDM14 localization by IF/ICC in cultured cells (…
When comparing conditions, consistent sample processing and appropriate negative/positive controls support interpretation of qualitative localization differences and quantitative abundance changes.
Notes for experimental interpretation
- Isoforms and post-translational modifications may shift apparent molecular weight or epitope accessibility, especially across cell states or treatments.
- Species and tissue context can affect sequence conservation, expression level, and background binding; predicted reactivity should be verified in your sample.
- Control concepts include isotype-matched controls, secondary-only controls (for indirect detection), and genetic/orthogonal controls (e.g., KO/KD, independent antibodies, or RNA measurements) when feasible.
Monoclonal and polyclonal antibodies can differ in epitope recognition breadth and lot-to-lot characteristics; consider clonality and clone information (when provided) alongside your assay requirements. Conjugated formats may simplify detection but can change background and multiplexing behavior compared with unconjugated primaries.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.