Recombinant Escherichia coli Colicin-Ia (cia) (626:I→I-QGISSRLAWYQQKPEKAPKSLIYARSPWGYYLDS)

SKU:BHP10516148 Promotion
Overview
Click light‑blue chips for details
Recombinant Escherichia coli cia protein (aa 1–626) produced in a E. coli. Supplied as liquid or lyophilized powder for assay development, binding studies, or mechanistic research (RUO).
Target cia
Species Escherichia coli
Expression Region 1-626aa(626:I→I-QGISSRLAWYQQKPEKAPKSLIYARSPWGYYLDS)
Conjugate(s) Tag-Free
Transmembrane Domain 2TM
Options selector
Catalog no. Size
CSB-EP361926ENLe1(M2)-1MG 1 mg
CSB-EP361926ENLe1(M2)-100UG 100 ug
CSB-EP361926ENLe1(M2)-20UG 20 ug
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Size (3) — 20 ug, 100 ug, 1 mg
  • Lead time: typically ships in 3-7 business days.
  • Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target cia
Alternative names cia
UniProt # P06716
Species Escherichia coli
Applications
  • Functional Assay (In Vitro)
  • ELISA
Conjugate
  • Tag-Free
Expression system
  • E.coli
Expression region 1-626aa(626:I→I-QGISSRLAWYQQKPEKAPKSLIYARSPWGYYLDS)
Molecular weight 73.4 kDa
Protein length Full Length
Purity Greater than 85% as determined by SDS-PAGE.
Activity
  • Not Test
Endotoxin level Not test
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Form Liquid or Lyophilized powder
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Storage buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Catalog no. (Mfr.) CSB-EP361926ENLe1(M2)
Main SKU BHP10516148

Overview

This recombinant protein is designed to support research on cia (also reported as cia) from Escherichia coli. In the supplied product notes, the target is described as This colicin is a channel-forming colicin.; the narrative below provides general biological context to help interpret experiments (research use only).

Key elements and design rationale

  • Target and identity: cia (also reported as cia). When working across orthologs or family members, confirm naming/synonyms and sequence-level relatedness to reduce ambiguity in downstream interpretation.
  • Expressed region: 1-626aa(626:I→I-QGISSRLAWYQQKPEKAPKSLIYARSPWGYYLDS). For many transmembrane proteins, recombinant constructs may focus on soluble domains or extracellular/luminal segments; the chosen region can shape which binding sites, motifs, or interaction surfaces are represented.
  • Expression system: E.coli. Expression host can influence folding efficiency and post-translational modifications (for example, disulfide bonding and glycosylation), which can matter for ligand-binding or antibody-recognition studies.
  • Format and quality attributes: form: Liquid or Lyophilized powder; purity: Greater than 85% as determined by SDS-PAGE.; molecular weight: 73.4 kDa. Use these attributes to anticipate detectability in assays and to plan appropriate controls and normalization strategies.

Recombinant proteins derived from membrane-associated targets are often studied as isolated domains to improve solubility and enable biophysical or immunochemical readouts.

Biological background

cia is a transmembrane or membrane-associated protein that can participate in signaling, transport, adhesion, or host–pathogen interactions depending on the biological system. Alternative naming conventions are common for membrane protein families; mapping synonyms to sequence identifiers (for example via UniProt/NCBI/Ensembl) can help avoid reagent mismatches. Ion channels often regulate membrane excitability and ionic homeostasis; observed changes in abundance or binding can reflect altered gating states, subunit composition, or compartment-specific trafficking.

Research relevance and current trends

  • Structure-enabled questions: cryo-EM, computational modeling, and integrative structural biology are increasingly used to connect domain-level constructs to full-length membrane protein architecture and interaction interfaces.
  • Context dependence: current work often emphasizes how lipid composition, membrane microdomains, and trafficking pathways modulate receptor/transport behavior and shape downstream signaling outputs.
  • Conformation and state-selective reagents: many studies focus on ligands, antibodies, or binders that preferentially recognize specific conformational states, supporting mechanistic hypotheses beyond simple abundance measurements.

Common research applications

  • Binding and interaction studies: use recombinant domains to evaluate whether a ligand, antibody, or receptor interaction is compatible with the expressed region and expected post-translational context.
  • Reference material for comparative measurements: when used as a calibrator, consider matrix effects and ensure the construct region matches the epitope or binding site being measured.
  • Structural and biophysical characterization: soluble domains can support stability screening, complex formation, and hypothesis generation about the full-length membrane protein.

When interpreting signal changes, distinguish between abundance effects (expression level), accessibility effects (conformation or compartment), and chemistry effects (post-translational modifications). For membrane-associated targets, trafficking and proteolytic processing can create multiple detectable species that differ from predicted mass.

Notes for experimental interpretation

  • Isoforms and truncations: alternative splicing or proteolytic processing can shift which domains are present in the native sample relative to the recombinant region.
  • Post-translational modifications: glycosylation, disulfide bonding, lipidation, and phosphorylation can alter apparent size and binding; expression-system differences may change these features.
  • Membrane environment: many binding sites and conformations are stabilized by lipids or neighboring subunits; isolated domains may not fully recapitulate full-length behavior.
  • Control concepts: include negative controls matched for tags or host background where relevant, and consider orthogonal evidence (e.g., genetic perturbation rationale such as knockout/knockdown) to support specificity claims.
What is protein expression and purification?
Protein expression is the biotechnological process of generating a specific protein. It can be done in prokaryotic, eukaryotic or In vitro E. coli expression system. Protein purification is a series of processes intended to isolate one or a few proteins from cells or organisms. The most popular method for protein purification is affinity chromatography, and which is designed by different protein tags. Other protein purification methods, including ion exchange chromatography, size-exclusion chromatography, polish purification and hydrophobic interaction chromatography are available to handle tag-free proteins with high purity.
Why is there no/low protein expression?
a. Incorrect vector construction. You should confirm vector by sequencing or apply for our custom clone service.

b. Rare codons. You should optimize codons, use strains supplementing rare codons, induce at lower temperature or grow in poor media.

c. Protein toxicity. You should use promoters with tighter regulation or lower plasmid copy number. Use pLysS/pLysE bearing strains in T7-based systems or strains that are better for the expression of toxic proteins. Start induction at high OD and shorten induction time. Add glucose when using expression vectors containing lac-based promoters.
How to avoid inclusion bodies and improve soluble expression?
a. Proteins with high hydrophobicity or transmembrane domains. You should add fusion tags or add heat shock chaperones. You should induce for a shorter time at low temperature or change to poor media. Generate truncated forms of protein or use membrane rich strains.

b. Incorrect disulfide bond formation. You should add fusion partners, including thioredoxin, DsbA, DsbC. Clone in a vector containing secretion signal peptide to cell periplasm. Use gamiB (DE3)strains with oxidative cytoplasmic environment. Lower inducer concentration and induction temperature.

c. Incorrect folding. You should use a fusion partner. Co-express with molecular chaperones. Use strains with cold-adapted chaperones. Supplement media with chemical chaperones and cofactors. Reduce the inducer concentration and add fresh media. Induce for a shorter time at low temperature.
Why is the molecular weight of protein smaller than the predicted?
a. Rare amino acids selenocysteine (Sec) or pyrrolysine (Pyl) in protein sequence. You should use some other amino acids to instead these two unusual amino acids.

b. Imbalanced translation process of fusion protein. You should change another fusion tag or move fusion tag to C-terminal. You should induce for a shorter time at low temperature or change to poor media.

c. Protein degradation. You should replace specific protease sites. Use protease deficient strains. Induce at high OD. You should induce for a shorter time at low temperature or use protease inhibitors when breaking cells.
Why is the actual band size different from the predicted?
a. Post-translational modification. Phosphorylation, glycosylation, etc which increases the size of the protein.

b. Post-translational cleavage. Many proteins are synthesized as pro-proteins, and then cleaved to give the active form.

c. Splice variants. Alternative splicing may create different sized proteins from the same gene.

d. Relative charge. The composition of amino acids have different relative charge which will affect the electrophoretic mobility.

e. Multimers such as dimerisation of a protein. This is usually prevented in reducing conditions, although strong interactions can result in the appearance of higher bands.

f. Protein structure such as disulfide bond, protein secondary structure or protein 3D structure formation.

g. Hydrophobic proteins, such as transmembrane proteins, may have difficulties in migrating into the gel, and thus resulting in different multi-banded patterns.
How to express a protein with bioactivity? Why is the protein inactive?
For gaining a protein with bioactivity, you should choose a right expression system, a suitable expression vector, an appropriate purification method and a validation experiment. You can learn more from this link: https://www.cusabio.com/c-20275.html. Otherwise, you can check the problems below:

a. Low solubility of the protein. You should fuse desired protein to a fusion partners and lower temperature.

b. Lack of essential post translational modification. You should change another expression system.

c. Incomplete folding. You should use a fusion partner and use strains with cold-adapted chaperones. Co-express with molecular chaperones at lower temperature. Monitor disulfide bond formation and allow further folding in vitro.

d. Mutations in cDNA. You should sequence plasmid before and after induction or use a recA− strain to ensure plasmid stability. Transform E. coli before each expression round.
Why are our protein products almost invisible in pipes?
CUSABIO protein product does not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, and lyophilized from low salt solution, so it often does not form a white grid structure, but a trace amount of protein deposit within the tube, forming a thin transparent or invisible protein layer.

Tips: Before opening the lid, we recommend to centrifuge in a small centrifuge for 20-30 seconds firstly to ensure that the contents are on the bottom of the tube. Our quality control steps ensure that the amount of protein contained in each tube is accurate, although sometimes you can’t see the protein powder, but the protein content in the tube is still very accurate.
How is the protein purified? Is the purity guaranteed?
We will design the optimal purification scheme according to the tag type of the fusion protein and the physicochemical properties of the protein itself. Our common purification methods are: affinity chromatography, hydrophobic chromatography, ion exchange chromatography, molecular sieve, salting out, etc. We guarantee a minimum purity standard of >85%. If the initial purification does not meet this standard or customer has higher purity requirement, we also have AKATA purification instrument, which is highly automated, precise control, combining the use of various column, to ensure that the purity of our protein product is further enhanced and the final purity test results are displayed on the COA report.

Although we guarantee a minimum purity standard of >85%, some of the proteins we prepared have a purity of 95% or even 97%.
How should I reconstitute and store the products?
Centrifugate the reagent tube before opening the cap.

As for short-term storage or usage, please use sterile deionized water to completely reconstitute proteins to 0.1-1.0 mg/mL. Aliquot after 10-15 minutes if needed and store at 4℃.

As for long-term storage, the cytokines or recombinant proteins are recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
What types of tags do you use for fusion?
The common tags we provide include His-tag, FLAG-tag, GST-tag, MBP-tag, combination tags (His-GST-tag, His-sumo-tag, His-MBP-tag), etc. Sometimes, the tag of proteins will be determined during the manufacturing process. If you have specified tag type, please feel free to consult with us. Click here to learn more about the general information of different tags.
What is the impact of a given tag type and any potential biological activity of the protein?
Theoretically small tags generally have very small influence on protein activity. However, the specific impact on protein activity can't be concluded (There is no impact on some proteins, small impact on some proteins, and relatively great impact on some proteins).
Can you remove the endotoxin?
Not all endotoxin can be removed. Please communicate with us in advance if you need to remove the endotoxin which takes 2-3 business days. We could offer endotoxin removal service free of charge using PMB affinity chromatography, use LAL reagent to semi-quantitatively detect the content of endotoxin and guarantee endotoxin level within 0.1 ng/μg (1 EU/μg).
Can you offer aseptic manufacture processing?
Yes, we can offer this service and it is free of charge, but you should remark this information when placing the order. We've performed aseptic processing for liquid protein before lyophilization, but there may exist contamination during lyophilization process, so we can't say germ-free for the whole process.
How to determine species cross-reactivity of cytokines?
a. Apart from a few exceptions, most human cytokines are active on mouse cells.

b. Many mouse cytokines may also have effect on human cells, however, the activity may be lower than the corresponding human cytokines.

c. One of the few human cytokines will be more active than corresponding mouse cytokines when acting on mouse cells, such as IL-7.

d. Interferon, GM-CSF, IL-3 and IL-4 and other cytokines are species-specific and almost have no activity on non-homologous cells.

e. In contrast, fibroblast growth factor (FGF) and neurotrophin are highly conserved and both have good activity on cells of different species.
What is the general preservative? Which kind of preservative do you usually add?
Commonly used preservative include Proclin 300, Sodium azide, etc. We do not add any preservative to our proteins.
What is the general protectant? What kind of protectant do you usually add?
Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Can’t Find What You’re Looking For? We can help you source the best match or customize a recombinant protein solution for your study. Options may include species (human/mouse/rat), protein region/domain (full-length vs fragment), tag or label (His/GST/FLAG/biotin/fluorescent), expression system (E. coli/HEK293/insect), purity grade, formulation (buffer, carrier-free, glycerol-free), activity/functional validation (binding or enzymatic assays), endotoxin level (low-endotoxin for cell-based work), mutants/variants (point mutations, isoforms), and bulk or custom packaging. Click Talk to a Scientist to submit a request form, email us at support@biohippo.com, or explore our Research Services for additional support. Our team will be in contact with you shortly.

Matches this product
20% OFF
20% Off Transmembrane Proteins
TM20
Matches this product
FREE SAMPLE
Free Sample – MycoFold™ Growth Factors
Limited time offer – availa... Request Free Sample
Matches this product
15% OFF
15% Off Proteins from Trusted Suppliers — Limited Time
Limited Time PT15OFF
15%OFF
15% Off Cancer Antibodies
Ends Sep 30 ONCO15
$50 OFF
$50 Off All ELISA Kits
Limited time ELISA50
10% OFF
10% OFF CELL LINES-Limited-Time Offer
Ends Sep 30 CELL10
FREE SAMPLE
Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme
Limited time offer – availa... FREESAMPLE

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today