| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNV LSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLT CATTRQVVNVVTTKIALK were used as the immunogen for the SARS-CoV-2 NSP3 antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
SARS-CoV-2 NSP3 Antibody is a research-use primary antibody intended for detection of SARS-COV-2 in experimental workflows. It is supplied in Antigen affinity purified format. Key antibody attributes include Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG. Applications listed for this product include ELISA. Species reactivity (as provided): Human.
Key elements and design rationale
- Target: SARS-COV-2 (SARS-CoV-2 NSP3) — selectivity and interpretation should be considered in the context of isoforms, post-translational modifications, and related family members when applicable.
- Format: Antigen affinity purified — format can influence background, multiplexing compatibility, and downstream detection strategies.
- Antibody identity: Rabbit, Polyclonal (rabbit origin), isotype Rabbit IgG — these attributes help align secondary reagents and controls (e.g., isotype-matched controls) with your assay design.
- Product notes (from provided description): Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined. ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.
Where multiple assay formats are possible, align the antibody format, host/isotype, and listed applications with your detection system and controls to support clear interpretation of signal.
Biological background
In this catalog, SARS-COV-2 is positioned within Infectious Disease, COVID-19 research contexts. For authoritative gene/protein nomenclature, domains/isoforms, and curated functional annotations, consult resources such as UniProt, NCBI Gene, and Ensembl.
Research relevance and current trends
- Higher-plex and spatially resolved readouts (e.g., multiplex IF/IHC, spatial omics) are increasing demand for well-characterized primary antibodies with clearly stated host/isotype and labeling strategies.
- Genetic perturbation controls (knockout/knockdown) and orthogonal measurements (e.g., RNA vs protein) are commonly used to strengthen target attribution when interpreting antibody-derived signals.
- Reproducibility initiatives emphasize transparent reporting of antibody identity (clone, host, isotype) and experimental context to improve cross-study comparability.
Common research applications
- ELISA: interpret changes in signal in the context of sample composition, epitope accessibility, and potential isoform/PTM differences across conditions.
- Typical workflow themes: ELISA binding assay, Specificity controls, Antibody titration.
- Workflow notes: Measure binding to SARSCOV2NSP3 peptide/protein by ELISA with dilution series (include blanks), Confirm specificity using KO/KD or peptide competition controls in your primary assay, Optimize antibody dilution across…
When comparing conditions, consistent sample processing and appropriate negative/positive controls support interpretation of qualitative localization differences and quantitative abundance changes.
Notes for experimental interpretation
- Isoforms and post-translational modifications may shift apparent molecular weight or epitope accessibility, especially across cell states or treatments.
- Species and tissue context can affect sequence conservation, expression level, and background binding; predicted reactivity should be verified in your sample.
- Control concepts include isotype-matched controls, secondary-only controls (for indirect detection), and genetic/orthogonal controls (e.g., KO/KD, independent antibodies, or RNA measurements) when feasible.
Monoclonal and polyclonal antibodies can differ in epitope recognition breadth and lot-to-lot characteristics; consider clonality and clone information (when provided) alongside your assay requirements. Conjugated formats may simplify detection but can change background and multiplexing behavior compared with unconjugated primaries.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.