SKP2 Antibody / S-phase kinase-associated protein 2

SKU:BHA17109053
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Catalog / Quick links
    Overview
    Click light‑blue chips for details
    Anti-SKP2 antibody (Rabbit, Polyclonal, Rabbit IgG) for WB, IHC-P, IF in research assays (RUO).
    Target SKP2
    Host Rabbit
    Reactivity Human, Mouse, Rat
    Isotype Rabbit IgG
    Application WB, IHC-P, IF
    Conjugate(s) Unconjugated
    Available Options

    Select the variant that best fits your experiment. Availability and lead time may vary by option.

    • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water; Size: 100 ug
    • Lead time: typically ships in ~2-3 business days; timing may vary by selected option.
    • Storage: After reconstitution, the SKP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
    • Shipping: cold-chain shipment (typically with ice packs).
    • Upon receipt: store at the recommended temperature as soon as possible.
    • Sales terms and conditions: Please review prior to ordering.
    Options selector
    Catalog no. Formulation Size
    RQ4170 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Field Specification
    Clonality
    • Polyclonal (rabbit origin)
    Host Rabbit
    Immunogen Amino acids ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL were used as the immunogen for the SKP2 antibody.
    Isotype
    • Rabbit IgG
    Product Type
    • Antibodies
    • Primary Antibodies
    Purity Antigen affinity purified
    Reactivity
    • Human
    • Mouse
    • Rat
    Storage After reconstitution, the SKP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
    Target SKP2
    UniProt # Q13309

    Overview

    SKP2 Antibody / S-phase kinase-associated protein 2 is a research-use antibody directed against SKP2. It is supplied for use in common immunoassay contexts such as WB, IHC-P, IF (RUO).

    Key elements and design rationale

    • Target: SKP2.
    • Description (provided): The F box protein Skp2 (S-phase kinase-associated protein 2) is oncogenic, and its frequent amplification and overexpression correlate with the grade of malignancy of certain tumors.
    • Antibody type: Rabbit, Polyclonal (rabbit origin), Rabbit IgG.
    • Format: Antigen affinity purified; Antigen affinity purified.
    • Species reactivity: tested: Human, Mouse, Rat.
    • Immunogen (if provided): Amino acids ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL were used as the immunogen for the SKP2 antibody..

    The information above helps you match the antibody format to your assay context, interpret species-dependent differences, and anticipate how epitope context (isoforms, PTMs, or conformational state) may influence signal.

    Biological background

    The F box protein Skp2 (S-phase kinase-associated protein 2) is oncogenic, and its frequent amplification and overexpression correlate with the grade of malignancy of certain tumors. Skp2 controls p300-p53 signaling pathways in cancer cells, making it a potential molecular target for cancer therapy. This gene positively regulates the G(1)-S transition by controlling the stability of several G(1) regulators, such as the cell cycle inhibitor p27. This study provides evidence of a role for an F-box protein in oncogenesis and establishes SKP2 as a protooncogene causally involved in the pathogenesis of lymphomas.

    For curated annotations (gene/protein naming, domains, isoforms, and pathway links) for SKP2, consult primary databases such as UniProt, NCBI Gene, and Ensembl.

    Research relevance and current trends

    • Context-dependent expression studies: researchers often examine SKP2 abundance and localization across perturbations (genetic, pharmacologic, or environmental) to connect phenotype to molecular changes.
    • Reagent reproducibility: there is growing emphasis on antibody specificity checks using orthogonal approaches (e.g., genetic perturbation or independent antibodies) and transparent reporting of clone/lot information.
    • Multi-modal datasets: antibody-based readouts are increasingly combined with transcriptomics and imaging to relate protein-level measurements to cell-state transitions.

    Common research applications

    • Western blotting (immunoblot) for relative detection of target protein abundance and apparent molecular weight.
    • Immunohistochemistry for spatial mapping of target expression across tissues and cell types.
    • Immunofluorescence for subcellular localization and cell-type specific expression patterns.

    When comparing conditions, interpret changes in signal in the context of sample composition, expected localization, and any known isoform complexity for the target.

    Notes for experimental interpretation

    • Isoforms and PTMs: alternative splicing or post-translational modifications can change epitope accessibility and apparent molecular weight; interpret bands/signals accordingly.
    • Cross-reactivity and matrix effects: background binding can vary by sample type, species, and blocking/detection chemistries; include appropriate negative controls.
    • Control concepts: where feasible, use genetic perturbation (KO/KD/overexpression), orthogonal assays, or independent antibodies to support specificity claims.

    Antibody considerations: Polyclonal reagents may recognize multiple epitopes and can increase sensitivity but may show broader binding profiles, while monoclonal clones provide a single-epitope readout that can improve consistency across experiments. If a conjugate is listed, the antibody supports more direct detection workflows; otherwise, it is typically used with a compatible secondary antibody.

    Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

    Research budgets are tight — we get it. That's why we've put together a fresh round of exclusive promotions designed to help you stock up on the reagents, kits, and consumables your lab depends on, without stretching your budget.

    🔬 What's on offer right now:

    10% Off Pre-Designed siRNA Sets

    15% Off Cancer Antibodies

    20% Off Transmembrane Proteins

    $50 Off All ELISA Kits

    50% Off Lab Consumables + Free Shipping

    $99 Pipette Filler Promotion Package

    BlasTaq 2X qPCR MasterMix - 50% OFF Limited Time Offer

    DENARASE® Endonuclease — 10% Off One Order

    10% OFF CELL LINES-Limited-Time Offer

    Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme

    Get a Quote

    Please use this form for bulk quantity requests or customized products.

    Contact Information

    Product Information

    Try Celltrypse Free – Request Your Sample Today

    Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

    Try Celltrypse Free – Request Your Sample Today

    Try Celltrypse Free – Request Your Sample Today

    Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

    Try Celltrypse Free – Request Your Sample Today