SOD2 Antibody

SKU:BHA17105235
Suppliers
NSJ Bioreagents
NSJ Bioreagents
Details Products
Overview
Click light‑blue chips for details
Rabbit polyclonal antibody against SOD2 Rabbit IgG. Supplied as Antigen affinity purified; Antigen affinity; for WB, IHC-P, ICC; in Human, Mouse, Rat samples.
Target SOD2
Host Rabbit
Reactivity Human, Mouse, Rat
Application(s) WB, IHC-P, ICC
Clonality Polyclonal
Options selector
Catalog no. Formulation Size
R31882 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: see the variant selector for available formats and sizes.
  • Lead time: 2–3 business days.
  • Storage: After reconstitution, the SOD2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20ºC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Mfr No R31882
Alternative Names SOD2
Clonality
  • Polyclonal
Host Rabbit
Immunogen Amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK of human SOD2 were used as the immunogen for the SOD2 antibody.
Isotype
  • Rabbit IgG
Product Type
  • Antibodies
  • Primary Antibodies
Purity Antigen affinity
Reactivity
  • Human
  • Mouse
  • Rat
Storage After reconstitution, the SOD2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Target SOD2
UniProt # P04179

Overview

SOD2 antibody supplied as a antigen affinity purified reagent for WB, IHC-P, ICC in Human, Mouse, Rat samples. This product is a polyclonal (rabbit origin) antibody (host: Rabbit; isotype: Rabbit IgG) intended for research use only. The target is commonly annotated with cytoplasmic localization context, which may inform staining patterns.

Key elements and design rationale

  • Antibody identity: Polyclonal (rabbit origin); host Rabbit; isotype Rabbit IgG.
  • Format and purification: format: Antigen affinity purified; purity: Antigen affinity.
  • Species reactivity (reported): Human, Mouse, Rat.
  • Applications (listed): WB, IHC-P, ICC.
  • Immunogen / epitope context: Amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK of human SOD2 were used as the immunogen for the SOD2 antibody..
  • Localization: Cytoplasmic (annotation-level guidance; cell state and isoforms can shift patterns).

These attributes help you align the antibody with the biological question (target state, sample type, and readout) while keeping interpretation grounded in appropriate controls.

Biological background

SOD2 is the intended antigen for this primary antibody. Reported biological context includes: SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Subcellular localization information (Cytoplasmic) can be useful when interpreting IF/ICC patterns and selecting compartment-enriched lysates for WB.

Research relevance and current trends

  • Post-translational modification mapping: phosphorylation-site–resolved antibodies are used to connect signaling inputs to target activation states and downstream readouts.
  • Spatial and single-cell approaches: imaging-based and cytometry workflows increasingly quantify heterogeneity and relocalization rather than only bulk abundance.
  • Interaction-centric biology: IP-based enrichment and proteomics are widely used to define complexes, binding partners, and context-specific interactomes.

Common research applications

  • Western blot (WB): compare relative abundance/isoform patterns across conditions and sample types; band shifts may reflect processing or post-translational modification.
  • IHC-P: commonly used to measure relative target levels or localization changes in the context of the experimental question.
  • Immunocytochemistry (ICC): visualize intracellular distribution and morphology-linked changes in cultured cells.

Across these readouts, differences in signal intensity, localization, or complex enrichment are typically interpreted alongside sample-matched controls and independent evidence to distinguish regulation from technical variation.

Notes for experimental interpretation

  • Isoforms, cleavage products, or post-translational modifications can alter apparent molecular weight and subcellular distribution; interpret bands and staining patterns in the context of expected biology and sample preparation.
  • Species differences and epitope conservation may affect binding; use matched positive controls and orthogonal evidence when comparing across organisms.
  • Control concepts: include appropriate isotype and secondary-only controls (for imaging), and consider genetic perturbations (knockout/knockdown/overexpression) or independent antibodies targeting distinct epitopes to strengthen conclusions.

Epitope context is defined by the immunogen description; when available, align this with known domains, PTM sites, or family homology to anticipate potential cross-reactivity patterns. As a polyclonal antibody, recognition spans multiple epitopes, which can improve detection across conformations but may broaden background depending on sample context.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today