STXBP2 Antibody / UNC18-2

SKU:BHA17105571
Overview
Click light‑blue chips for details
Anti-STXBP2 / UNC18-2 antibody (Rabbit; polyclonal; Rabbit IgG; antigen affinity–purified) for WB, IF, FACS in Human, Mouse, Rat samples in research assays (RUO).
Target STXBP2
Host Rabbit
Reactivity Human, Mouse, Rat
Isotype Rabbit IgG
Application(s) WB, IF, FACS
Conjugate(s) Unconjugated
Options selector
Catalog no. Formulation Size
R32239 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Available Options

Select the variant that best fits your experiment. Availability and lead time may vary by option.

  • Options: Formulation: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
    Size: 100 ug
  • Lead time: usually 2-3 business days, ; please contact us for current fulfillment timing.
  • Storage: After reconstitution, the STXBP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Shipping: cold-chain shipment (typically with ice packs).
  • Upon receipt: store at the recommended temperature as soon as possible.
  • Sales terms and conditions: Please review prior to ordering.
Field Specification
Target STXBP2
UniProt # Q15833
Host Rabbit
Clonality
  • Polyclonal (rabbit origin)
Isotype
  • Rabbit IgG
Reactivity
  • Human
  • Mouse
  • Rat
Applications
  • Western Blot
  • Immunofluorescence
  • Flow Cytometry
Immunogen Amino acids QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD of human STXBP2 were used as the immunogen for the STXBP2 antibody.
Conjugate
  • Unconjugated
Purity Antigen affinity
Storage After reconstitution, the STXBP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Storage buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Catalog no. (Mfr.) R32239
Main SKU BHA17105571

Overview

STXBP2 Antibody / UNC18-2 is a research-use-only Rabbit polyclonal (rabbit origin) Rabbit IgG directed against STXBP2 / UNC18-2. It is supplied for interpretation-focused detection and comparative profiling in WB, IF, FACS.

Key elements and design rationale

  • Target context: This antibody is raised against Amino acids QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD of human STXBP2 were used as the immunogen for the STXBP2 antibody.. Epitope context matters because isoforms, processing, and post-translational modifications can change what is accessible in a given assay.
  • Format: Antigen affinity purified. Format influences background and compatibility with different detection chemistries; conjugated formats (when present) can simplify multiplexing and reduce reliance on secondary reagents.
  • Species reactivity: Human, Mouse, Rat. Cross-species performance can vary with sequence divergence and epitope conservation, so interpretation should be anchored with appropriate biological controls.
  • Applications: WB, IF, FACS. These indicate assay contexts where the antibody is commonly applied; actual performance depends on sample type and processing.
  • Limitations: This STXBP2 antibody is available for research use only.. Consider these constraints when selecting controls and when comparing results across sample matrices.

Polyclonal reagents can differ in how they recognize epitope features. Monoclonal antibodies often provide more consistent epitope targeting across lots, while polyclonal preparations may broaden recognition across related epitope variants.

Biological background

STXBP2 / UNC18-2 refers to the gene/protein target stated in the product record. Protein targets can exhibit context-dependent expression, regulated turnover, isoform diversity, and post-translational modifications that affect apparent molecular weight and epitope accessibility. For curated functional annotation, sequence features, and expression context, consult UniProtKB Q15833, Ensembl, and Human Protein Atlas.

Research relevance and current trends

  • Integrating antibody-based detection with single-cell and spatial atlasing efforts to connect RNA programs with protein-level abundance and localization in defined cell states.
  • Expanding multiplexed imaging and high-content screening, where reagent specificity, cross-reactivity risk, and channel design (including direct conjugates) become central to interpretation.
  • Growing emphasis on reproducibility and application-specific validation frameworks (e.g., genetic perturbation controls, orthogonal measurements, and independent antibody strategies) when drawing mechanistic conclusions.

Common research applications

  • Western blot (WB): commonly used to compare relative abundance/size (e.g., band intensity or mobility shifts) between conditions.
  • Immunofluorescence (IF): commonly used to compare subcellular localization patterns and redistribution across stimuli or phenotypes.
  • FACS: commonly used for qualitative/quantitative detection where compatible with the assay context.

Interpretation typically focuses on relative differences (presence/absence, fold-changes, compartment shifts, or population-level shifts) rather than absolute quantitation. When signal changes are observed, they may reflect altered expression, altered localization/trafficking, changes in modification state, or differences in sample composition; orthogonal readouts and appropriate controls help distinguish these possibilities.

Application details (record-specific): Western blot: 0.1-0.5ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells

Application notes (record-specific): Optimal dilution of the STXBP2 antibody should be determined by the researcher.

Notes for experimental interpretation

  • Product description (record-specific): Syntaxin-binding protein 2, also known as UNC18B and UNC18-2, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
  • Potential confounders: isoforms, proteolytic processing, and PTMs can change epitope presentation and apparent size; fixation/denaturation state can also expose or mask epitopes. Species differences near the epitope may affect cross-reactivity.
  • Control concepts: include genetic perturbation (KO/KD) or overexpression comparisons, orthogonal measurement (e.g., transcript or proteomics), and independent antibody/epitope strategies. For conjugated reagents, include staining-only/background controls appropriate to the detection chemistry.

Immunogen/epitope context is described as: Amino acids QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD of human STXBP2 were used as the immunogen for the STXBP2 antibody.. Monoclonal and polyclonal formats differ in epitope breadth; this can influence sensitivity to sequence variants, isoforms, or PTM-dependent recognition.

Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.

Ending soon
15%OFF
15% Off Cancer Antibodies
Ends Sep 30 ONCO15
$50 OFF
$50 Off All ELISA Kits
Limited time ELISA50
Ending soon
10% OFF
10% OFF CELL LINES-Limited-Time Offer
Ends Sep 30 CELL10
FREE SAMPLE
Free Sample – CellTrypase Recombinant Trypsin-Like Enzyme
Limited time offer – availa... FREESAMPLE
FREE SAMPLE
Free Sample – MycoFold™ Growth Factors
Limited time offer – availa... Request Free Sample

Get a Quote

Please use this form for bulk quantity requests or customized products.

Contact Information

Product Information

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today

Try Celltrypse Free – Request Your Sample Today

Experience the power of Celltrypse™, c-LEcta's innovative enzyme solution for gentle and efficient cell dissociation. Request your free sample and discover a superior alternative for your cell culture workflows.

Try Celltrypse Free – Request Your Sample Today