| Field | Specification |
|---|---|
| Mfr No | |
| Accession Number | |
| Alternative Names | ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A |
| Cellular Localization | |
| Clonality | |
| Concentration | |
| Host | |
| Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Isotype | |
| Product Type | |
| Reactivity | |
| Shipping | |
| Storage | |
| Target |
Sulfonylurea receptor 2A (SUR2A), encoded by the ABCC9 gene, is a regulatory subunit of ATP-sensitive potassium (KATP) channels, which serve as metabolic sensors linking cellular energy status to membrane excitability. SUR2A partners with Kir6.1 or Kir6.2 subunits to form functional KATP channels, which open or close in response to intracellular ATP and ADP levels. This dynamic regulation allows cells to adapt to metabolic stress by modulating ion flux and electrical activity.
While SUR2A is well-characterized in cardiac and skeletal muscle, its emerging role in the central nervous system is gaining attention. In neurons and glial cells, SUR2A-containing KATP channels help maintain ionic homeostasis, protect against excitotoxicity, and support mitochondrial function under stress conditions. These properties are particularly relevant in the context of neurodegenerative diseases, where energy failure, oxidative stress, and inflammation contribute to progressive neuronal loss.
Recent studies suggest that SUR2A may influence neurovascular coupling, blood-brain barrier integrity, and neuronal survival pathways—making it a promising target for therapeutic intervention in disorders such as Alzheimer’s disease, Parkinson’s disease, and stroke. Modulating SUR2A activity could offer neuroprotective benefits by enhancing cellular resilience to metabolic and oxidative insults.
Understanding the role of SUR2A in brain metabolism and neuroprotection is critical for advancing novel strategies in neurodegenerative disease research.
1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Cite this product varies by variant:
- SMC-431D — Size: 100 ug: SUR2A Antibody (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D, RRID: AB_2701505)
- SMC-431D-A390 — Size: 100 ug: SUR2A Antibody: ATTO 390 (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D-A390, RRID: AB_2701506)
- SMC-431D-A488 — Size: 100 ug: SUR2A Antibody: ATTO 488 (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D-A488, RRID: AB_2701507)
- SMC-431D-A594 — Size: 100 ug: SUR2A Antibody: ATTO 594 (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D-A594, RRID: AB_2701509)
- SMC-431D-APC — Size: 100 ug: SUR2A Antibody: APC (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D-APC, RRID: AB_2701515)
- SMC-431D-BI — Size: 100 ug: SUR2A Antibody: Biotin (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D-BI, RRID: AB_2701516)
- SMC-431D-FITC — Size: 100 ug: SUR2A Antibody: FITC (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D-FITC, RRID: AB_2701517)
- SMC-431D-HRP — Size: 100 ug: SUR2A Antibody: HRP (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D-HRP, RRID: AB_2701518)
- SMC-431D-PCP — Size: 100 ug: SUR2A Antibody: PerCP (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D-PCP, RRID: AB_2701520)
- SMC-431D-RPE — Size: 100 ug: SUR2A Antibody: RPE (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431D-RPE, RRID: AB_2701521)
- SMC-431S — Size: 12 ug: SUR2A Antibody (StressMarq Biosciences | Victoria, BC CANADA, Catalog# SMC-431S, RRID: AB_2701505)
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.
2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.
