| Field | Specification |
|---|---|
| Mfr No | |
| Clonality | |
| Host | |
| Immunogen | Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the TCF-8 antibody. |
| Isotype | |
| Product Type | |
| Purity | |
| Reactivity | |
| Storage | |
| Target | |
| UniProt # |
Overview
TCF-8 Antibody / ZEB1 / AREB6 is an antibody targeting ZEB1, raised in Mouse for protein detection and localization studies where these specifications are required.
Key elements and design rationale
- Target: ZEB1 (reported localization: Nuclear).
- Antibody identity: Monoclonal (mouse origin); Clone 8B12D1; Mouse IgG2b.
- Conjugate/label: Unconjugated (affects detection chemistry and multiplex compatibility).
- Format: Antigen affinity purified.
- Species reactivity: Human, Mouse, Rat.
- Listed applications: WB, IHC-P (refer to on-page specifications for application-specific guidance).
Biological background
ZEB1 (Zinc Finger E Box-Binding Homeobox 1), also called TCF8, AREB6, NIL2A or DELTA-EF1, is a protein that in humans is encoded by the ZEB1 gene. Fluorescence in situ hybridization localized the ZEB1 gene to chromosome 10p11.2. Krafchak et al. (2005) demonstrated a complex (core plus secondary) binding site for TCF8 in the promoter of the COL4A3 gene, mutant in Alport syndrome and which encodes collagen type IV alpha-3. They detected expression of TCF8 in cornea. Nishimura et al. (2006) found that delta-Ef1 was upregulated during differentiation in a mouse smooth muscle cell (SMC) line.
Research relevance and current trends
- Comparative expression profiling across cell types, tissues, or perturbations (e.g., drug treatment, genetic editing, or differentiation).
- Subcellular localization and trafficking studies, including co-localization with pathway markers in microscopy-based assays.
- Integration of protein-level measurements with transcriptomics or proteomics to relate abundance to regulation and phenotype.
Common research applications
- Western blotting: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
- Immunohistochemistry: researchers commonly compare relative signal levels across conditions and use appropriate negative/positive controls for interpretation.
Interpretation should account for antibody-dependent factors such as epitope accessibility, isoforms, and sample preparation differences across workflows.
Notes for experimental interpretation
- Isoforms and PTMs: many targets have multiple isoforms and post-translational modifications that can shift apparent signal or localization; interpret bands/signals accordingly.
- Epitope context: binding can depend on protein conformation and sample processing; region information in the title/immunogen can help anticipate what may be detected.
- Species differences: predicted or validated reactivity may vary by ortholog sequence and sample context; confirm in your model system.
- Control concepts: include negative controls (no-primary/isotype), and where possible genetic controls (KO/KD) or independent antibodies to strengthen conclusions.
Customization & Add-ons: Can’t find the antibody you need—or require a custom format for your assay? We can help you source the best match or support custom antibody solutions for diverse research needs, including species and isotype selection, conjugations and labeling (e.g., HRP/AP, biotin, fluorophores), purification grade options (Protein A/G, affinity purified), formulation preferences (buffer selection, carrier-free, glycerol-free), custom concentrations and aliquoting, low-endotoxin options for cell-based work, and application-focused QC/validation support (project dependent). Click Talk to a Scientist to submit a request, email us at support@biohippo.com, or explore our Research Services for additional support—our team will follow up with feasibility details and next steps.